« Back
Home /
Recombinant human Mitochondrial import inner membrane translocase subunit TIM16

Recombinant human Mitochondrial import inner membrane translocase subunit TIM16

Item no.	OPCA00306-20UG
Manufacturer	AVIVA Systems Biology
Amount	20 ug
Category	Neuroscience Neural Mitochondrial Function Molecular Targets for Neuroscience Targets for Rodent Neurosciences Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid
Specific against	Human (Homo sapiens)
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT
Citations	Identification and characterization of Magmas, a novel mitochondria-associated protein involved in granulocyte-macrophage colony-stimulating factor signal transduction.Jubinsky P.T., Messer A., Bender J., Morris R.E., Ciraolo G.M., Witte D.P., Hawley R.G., Short M.K.Exp. Hematol. 29:1392-1402(2001)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CGI-136;MAGMAS;magmas-like protein;mitochondria associated protein involved in granulocyte macrophage colony stimulating factor signal transduction;mitochondria-associated granulocyte macrophage CSF-signaling molecule;mitochondrial import inner membrane translocase subunit TIM16;presequence translocase associated motor 16 homolog;Presequence translocated-associated motor subunit PAM16;SMDMDM;TIM16;TIMM16.
Available
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Molecular Weight	40.8 kDa
Gene symbol	PAM16
Gene Fullname	presequence translocase associated motor 16
Protein size	Recombinant
Product format	Liquid or Lyophilized powder
Reconstitution and storage	-20°C or -80°C
Description of target	Regulates ATP-dependent protein translocation into the mitochondrial matrix. Inhibits DNAJC19 stimulation of HSPA9/Mortalin ATPase activity.
Protein name	Mitochondrial import inner membrane translocase subunit TIM16
Storage Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OPCA00306-20UG-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ug

available

Delivery expected until 1/29/2026

Express Delivery: Save 10 days

Compare

Add to wishlist

Get an offer