Comparison

Fibroblast Growth Factor 21, Recombinant, Mouse, aa29-210, His-Tag (FGF-21, FGF21)

Item no. USB-370613-100UG
Manufacturer United States Biological
Amount 100 ug
Quantity options 20 ug 100 ug
Category
Type Cytokines and Growth Factors
Format Liquid
Specific against other
Purity ≥90% (SDS-PAGE)
ECLASS 10.1 42030690
ECLASS 11.0 42030690
UNSPSC 12352202
Shipping Condition Cool pack
Available
Manufacturer - Category
Molecular Biology / MB-Growth Factors-FGF
Shipping Temperature
Blue Ice
Storage Conditions
-20°C
Molecular Weight
23, 9
Grade
Purified
Form
Supplied as a liquid in Tris, 50% glycerol.
EU Commodity Code
30021019
Description
Stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression (but not SLC2A4/GLUT4 expression). Activity probably requires the presence of KLB.

Source:
Recombinant protein corresponding to aa29-210 from mouse Fibroblast Growth Factor 21, fused to 6xHis-Tag at N-terminal, expressed in E. coli.

Molecular Weight:
~23.9kD

Amino Acid Sequence:
AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Shelf Life
6 months

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close