PON1

Item no.	enz-299-1mg
Manufacturer	ProSpec
Amount	1 mg
Quantity options	10 ug 1 mg 2 ug
Category	Neuroscience Metabolism Diabetes Molecular Targets for Neuroscience Neural Development Peptides & Proteins Enzymes
Type	Enzymes
Format	Liquid
Specific against	Human (Homo sapiens)
Purity	Greater than 95% as determined by SDS-PAGE. <br />Single band on Western Blot.
Sequence	MAKLIALTLLGMGLALFRNHQSSYQTRLNALREVQPVELPNCNLVKGIE TGSEDLEILPNGLAFISSGLKYPGIKSFNPNSPGKILLMDLNEEDPTVLE LGITGSKFDVSSFNPHGISTFTDEDNAMYLLVVNHPDAKSTVELFKFQE EEKSLLHLKTIRHKLLPNLNDIVAVGPEHFYGTNDHYFLDPYLRSWEM YLGLAWSYVVYYSPSEVRVVAEGFDFANGINISPDGKYVYIAELLAHKIHV YEK
ECLASS 10.1	32160410
ECLASS 11.0	32160410
UNSPSC	12352204
Alias	PON1,Serum paraoxonase,arylesterase 1,EC 3 1 1 2,EC 3 1 8 1,PON 1,Serum aryldialkylphosphatase 1,A-esterase 1,Aromatic esterase 1,K-45,ESA,PON
Similar products	PON1
Available
Manufacturer - Category	ENZYMES
Storage Conditions	Store at 4C if entire vial will be used within 1-2 weeks. Store, frozen at -20C for longer periods of time. Avoid multiple freeze-thaw cycles.
Description	Recombinant Human Paraoxonase-1
Formulation	PON1 is supplied in 20mM Tris-HCl pH 8.0 and 50% glycerol.
Introduction	Paraoxonase 1 also called Esterase-A is involved in the detoxification of organophosphate insecticides such as parathion. Paraoxonase 1 may also confer protection against coronary artery disease by destroying proinflammatory oxidized lipids present in oxidized low-density lipoproteins (LDLs).
Usage	ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Manufacturer - Format	Sterile Filtered clear solution.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

enz-299-1mg-safety-datasheet.pdf