« Back
Home /
Recombinant Human Paraoxonase-1

Recombinant Human Paraoxonase-1

Item no.	enz-299-2ug
Manufacturer	ProSpec
Amount	2ug
Category	Neuroscience Metabolism Diabetes Molecular Targets for Neuroscience Neural Development Peptides & Proteins Enzymes
Type	Enzymes
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160410
ECLASS 11.0	32160410
UNSPSC	12352204
Similar products	PON1
Available
Synonyms	Serum paraoxonase, arylesterase 1, EC 3 1 1 2, EC 3 1 8 1, PON 1, Serum aryldialkylphosphatase 1, A-esterase 1, Aromatic esterase 1, K-45, ESA, PON
Introduction	Paraoxonase 1 also called Esterase-A is involved in the detoxification of organophosphate insecticides such as parathion. Paraoxonase 1 may also confer protection against coronary artery disease by destroying proinflammatory oxidized lipids present in oxidized low-density lipoproteins (LDLs).
Description	Paraoxonase-1 Isoform Human Recombinant is expressed in E. coli having a molecular weight of 42.9 kDa and fused to a 4.5kDa amino terminal hexahistidine tag. The PON1 purified by proprietary chromatographic techniques.
Source	Escherichia Coli.
Physical Appearance	Sterile Filtered clear solution.
Formulation	PON1 is supplied in 20mM Tris-HCl pH 8.0 and 50% glycerol.
Purity	Greater than 95% as determined by SDS-PAGE. Single band on Western Blot.
Usage	ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Amino acid sequence	MAKLIALTLLGMGLALFRNHQSSYQTRLNALREVQPVELPNCNLVKGIE TGSEDLEILPNGLAFISSGLKYPGIKSFNPNSPGKILLMDLNEEDPTVLE LGITGSKFDVSSFNPHGISTFTDEDNAMYLLVVNHPDAKSTVELFKFQE EEKSLLHLKTIRHKLLPNLNDIVAVGPEHFYGTNDHYFLDPYLRSWEM YLGLAWSYVVYYSPSEVRVVAEGFDFANGINISPDGKYVYIAELLAHKIHV YEKHANWTLTPLKSLDFNTLVDNISVDPETGDLWVGCHPNGMKIFFYD SENPPASEVLRIQNILTEEPKVTQVYAENGTVLQGSTVASVYKGKLLIGT VFHKALYCELZ.
Storage	Store at 4C if entire vial will be used within 1-2 weeks. Store, frozen at -20C for longer periods of time. Avoid multiple freeze-thaw cycles.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

enz-299-2ug-safety-datasheet.pdf