Comparison

human Cardiotrophin-1 European Partner

Item no. ALO-C-200-10ug
Manufacturer Alomone
Amount 10 ug
Quantity options 10 ug 25 ug 5 ug
Category
Type Proteins Recombinant
Format Lyophilized
Applications WB
Specific against other
Purity ≥98% (HPLC)
Formula Lyophilized from double distilled water (ddH2O).
Sequence SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Shipping Condition Room temperature
Available
Manufacturer - Type
Non Antibodies
Manufacturer - Category
Proteins
Manufacturer - Targets
ILST/gp130 receptors
Country of Origin
Israel
Shipping Temperature
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Storage Conditions
Storage as Solution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. - Storage before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. - Storage after Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Molecular Weight
21.1 kDa
Manufacturer - Format
Lyophilized
Short description
human Cardiotrophin-1, Recombinant, E. coli
Description
CT-1 - human Cardiotrophin-1, Recombinant, E. coli
Reconstitution
Centrifuge the vial (10, 000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeated freeze-thaw cycles may result in loss of activity.
Specificity

human Cardiotrophin-1, Recombinant, E. coli

PH
7, 4
UNSPSC
12352202
Effective Concentration
10 - 100 nM
Activity
Cardiotrophin-1 is a member of the neuropoietic cytokine family which enhances the survival of ciliary and dopaminergic neurons through the interaction with the gp130 receptor. Cardiotrophin-1 induces cardiac myocyte hypertrophy and has been shown to promote the survival of both embryonic and neonatal rat ventricular muscle cells1-3.
Solubility
Centrifuge the vial before adding solvent (10, 000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeat freeze-thawing may result in loss of activity.
Sterile endotoxin free
yes
Bioassay tested
yes
Endotoxin level
<0.1 EU per 1 µg of the protein by the LAL method.
Scientific Background
Cardiotrophin-1 is a member of the neuropoietic cytokine family (LIF, CNTF, OSM IL-11, IL-6). Cardiotrophin-1 is a strong inducer of cardiac hypertrophy, exerts cardio-protective effects and plays a role in neuronal growth and differentiation.1, 2In neonatal rat, Cardiotrophin-1 has been shown to promote cardiac myocyte survival and to enhance embryonic myocyte proliferation during cardiac chamber development.3 Cardiotrophin-1 increases angiotensinogen gene transcription and induces VEGF expression in cardiac myocytes.4, 5 It also induces vessel growth during cardiac remodelling, an effect that may contribute to its cardio-protective properties.In humans, a recent report showed an increase in circulating Cardiotrophin-1 in heart failure.6 A strong correlation between the increased Cardiotrophin-1 and the severity of left ventricular systolic dysfunction was found.7Cardiotrophin-1 is a very potent neurotrophic factor for motoneurons in long-term culture and protects neonatal rat motoneurons from axotomy-induced cell death.2, 8 It was able to modulate the synthesis of specific neurotransmitters by cultured neuronal cells, 9 and to promote the survival of rat dopaminergic and chick ciliary neurons.10 Recently, the potential for neuroprotection by Cardiotrophin-1 was investigated in animal models characterized by a prominent axonal degeneration.11-13

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Delivery expected until 1/29/2026 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close