Comparison

human LIF European Partner

Item no. ALO-L-200-0.5mg
Manufacturer Alomone
Amount 0.5 mg
Quantity options 0.1 mg 0.25 mg 0.5 mg 10 ug 1 mg 50 ug 5 ug
Category
Type Proteins Recombinant
Format Lyophilized
Applications WB
Specific against other
Purity ≥98% (HPLC)
Formula Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Sequence SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF-OH
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Shipping Condition Room temperature
Available
Manufacturer - Type
Non Antibodies
Manufacturer - Category
Proteins
Manufacturer - Targets
LIF receptor (LIFR-α)
Country of Origin
Israel
Shipping Temperature
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Storage Conditions
Storage as Solution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. - Storage before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. - Storage after Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Molecular Weight
19.7 kDa
Manufacturer - Format
Lyophilized
Short description
Human Leukemia Inhibitory Factor, Recombinant, E. coli
Description
Leukemia Inhibitory Factor - Human Leukemia Inhibitory Factor, Recombinant, E. coli
Reconstitution
Centrifuge the vial (10, 000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeated freeze-thaw cycles may result in loss of activity.
Specificity

Human Leukemia Inhibitory Factor, Recombinant, E. coli

PH
7, 4
UNSPSC
12352202
Effective Concentration
EC50 = ~10 pM
Activity
LIF is a lymphoid factor which promotes long-term maintenance of embryonic stem cells by suppressing spontaneous differentiation. LIF regulates cholinergic, peptidergic and noradrenergic properties of sympathetic neurons and rescues sensory and motor neurons from death. LIF also promotes differentiation of O-2A astrocytes1-4.
Solubility
Centrifuge the vial before adding solvent (10, 000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeat freeze-thawing may result in loss of activity.
Sterile endotoxin free
no
Bioassay tested
yes
Endotoxin level
<0.1 EU per 1 µg of the protein by the LAL method.
Scientific Background
Leukemia inhibitory factor (LIF) was identified by its ability to induce terminal differentiation in leukemic cells.1, 2 LIF is a pleiotrophic factor with known actions in the immune system, the nervous system and the reproductive systeM3, 4In the nervous system it acts on cultured sympathetic neurons to direct a change in neurotransmitter expression from a noradrenergic to a cholinergic phenotype and regulates the expression of neuropeptide transmitters in these cells.5, 6In the immune system LIF plays a key role in inflammation, 7, 8 with a pro-inflammatory role in rheumatoid arthritis, 9 but also with proposed anti-inflammatory properties in lung inflammatory processes.In the reproductive system, LIF appears to play an important role in implantation and in the establishment of pregnancy.10, 12 LIF acts as a trophic factor for oligodendrocytes and promotes astrocytic survival and differentiation.13, 14 It exhibits activity towards spinal motor neurons and stimulate the biosynthesis of acetylcholine.6LIF also functions as a trophic factor for peripheral sensory neurons supporting their survival.15, 16 LIF appears to be essential for injury-induced neuropeptide synthesis17 and can also stimulate the hypothalamic-pituitary-adrenal axis in response to stress and disease.18 LIF is used extensively in experimental biology because of its ability to induce embryonic stem cells to retain their totipotentiality.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 0.5 mg
Available: In stock
available

Delivery expected until 1/8/2026 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close