Comparison

human Neurotrophin-4 (NT-4) European Partner

Item no. ALO-N-270-10ug
Manufacturer Alomone
Amount 10 ug
Quantity options 0.1 mg 0.25 mg 0.5 mg 10 ug 1 mg 25 ug 50 ug 5 ug
Category
Type Proteins Recombinant
Format Lyophilized
Applications WB
Specific against other
Purity ≥98% (HPLC)
Formula Lyophilized from filtrated Ammonium acetate solution. May contain acetate as a residual counter ion.
Sequence MGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Shipping Condition Room temperature
Available
Manufacturer - Type
Non Antibodies
Manufacturer - Category
Proteins
Manufacturer - Targets
p75NTR, TrkB receptors
Country of Origin
Israel
Shipping Temperature
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Storage Conditions
Storage as Solution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. - Storage before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. - Storage after Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Molecular Weight
28.1 kDa (dimer)
Manufacturer - Format
Lyophilized
Short description
Human Neurotrophin-4, Recombinant, E. coli
Description
Neutrophic factor 4, NT-4, Neurotrophin-5 (NT-5) - Human Neurotrophin-4, Recombinant, E. coli
Reconstitution
Centrifuge the vial (10, 000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeated freeze-thaw cycles may result in loss of activity.
Specificity

Human Neurotrophin-4, Recombinant, E. coli

PH
7, 4
UNSPSC
12352202
Effective Concentration
1 - 10 ng/ml
Activity
NT-4 is involved in many biological outcomes including promoting dendritic outgrowth and Ca2+ currents in cultured mesencephalic dopamine neurons1, promoting growth and remodeling of adult motor neuron innervation2. The biological effects of NT-4 are mediated by two receptors: TrkB which is specific for NT-4 and BDNF, and p75NTR which binds all the neurotrophins3.
Solubility
Centrifuge the vial before adding solvent (10, 000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeat freeze-thawing may result in loss of activity.
Sterile endotoxin free
yes
Bioassay tested
yes
Endotoxin level
<0.1 EU per 1 µg of the protein by the LAL method.
Scientific Background
The neurotrophins ("neuro" means nerve and "trophe" means nutrient) are a family of soluble, basic growth factors which regulate neuronal development, maintenance, survival and death in the CNS and PNS.1Neurotrophin-4 (NT-4) is expressed in neurons of the superior cervical, stellate and celiac ganglion, 2 T-cells3 and is synthesized by keratinocytes.4The structural hallmark of all the neurotrophins is the characteristic arrangement of the disulfide bridges known as the cysteine knot, which has been found in other growth factors such as PDGF.5The rat and human forms of NT-4 are 96% homologous. NT-4 has been shown to promote dendritic outgrowth and calcium currents in cultured mesencephalic dopamine neurons, 6 to promote growth and remodeling of adult motor neuron innervation, 7 to be anterograde survival factors for postsynaptic cells8 and to protect against apoptotic neuronal death.9The biological effects of NT-4 are mediated by two receptors: TrkB which is specific for NT-4 and BDNF, and p75NTR which binds all the neurotrophins.10

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Delivery expected until 1/8/2026 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close