Comparison

human proNGF (cleavage resistant) European Partner

Item no. ALO-N-285-5ug
Manufacturer Alomone
Amount 5 ug
Quantity options 0.1 mg 0.25 mg 0.5 mg 10 ug 1 mg 25 ug 50 ug 5 ug
Category
Type Proteins Recombinant
Format Lyophilized
Specific against other
Purity ≥98% (HPLC)
Formula Lyophilized from filtrated Ammonium acetate solution. May contain acetate as a residual counter ion.
Sequence MEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSAASSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA (the prodomain is shown in bol
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Shipping Condition Room temperature
Available
Manufacturer - Type
Non Antibodies
Manufacturer - Applications
Neurite outgrowth assay, Cell survival assay
Manufacturer - Category
Proteins
Manufacturer - Targets
p75NTR, VPS10 domain-containing receptors
Country of Origin
Israel
Shipping Temperature
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Storage Conditions
Storage as Solution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. - Storage before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. - Storage after Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Molecular Weight
49.9 kDa (dimer)
Manufacturer - Format
Lyophilized
Short description
Human proNerve Growth Factor, Recombinant, E. coli
Description
proNerve Growth Factor - Human proNerve Growth Factor, Recombinant, E. coli
Reconstitution
Centrifuge the vial (10, 000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. Repeated freeze-thaw cycles may result in loss of activity.
Specificity

Human proNerve Growth Factor, Recombinant, E. coli

PH
7, 4
UNSPSC
12352202
Effective Concentration
0.4 - 4 nM
Activity
proNGF is the preferred ligand of p75NTR 1. In contrast to its mature form proNGF induces apoptosis via p75NTR 1, but can also mediate cell survival in DRGs2.
Solubility
Centrifuge the vial before adding solvent (10, 000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. Repeat freeze-thawing may result in loss of activity.
Sterile endotoxin free
yes
Bioassay tested
yes
Endotoxin level
<0.1 EU per 1 µg of the protein by the LAL method.
Scientific Background
The proneurotrophins (proNT) are, as their name suggests, the proform of the neurotrophins. The neurotrophins (NT) are a family of soluble, basic growth factors which regulate neuronal development, maintenance, survival and death in the CNS and the PNS.1 They exert their biological effects by binding to two types of receptors: the Trk receptors, and the p75NTR receptor.Like many other proteins, mature NT arise from the proteolytic cleavage of the precursor form by various proteases: plasmin, furin, MP7, PC1/3, PC2, PC5/6, PC7 and PACE4, which cut behind a pair or even a single basic residue.2 This has been known for many years, and it was thought that the roles of the prodomain were to aid in the folding of the mature protein and to sort the mature neurotrophin into the various secretion pathways.3 However, recently an assortment of papers have been published which suggest new roles for the proNT. It has been found that proNerve Growth Factor (proNGF), and not mature NGF, is the predominant isoform found in the human brain as well as in a variety of cell types, including mast cells, sciatic nerve cells, thyroid gland, skeletal muscle, prostate gland, hippocampus and hair follicle.4 Thus, the case of the mouse salivary gland, which is the most abundant source of mature NGF, seems to be the exception and not the rule.proNGF is the ligand preferred by p75NTR.5 Therefore, cleavage resistant proNGF (mutated at the cleavage site to insure that it retains the prodomain) induced apoptosis ten times more effectively than mature NGF in a vascular smooth muscle cell line expressing p75NTR but not Trk receptors.5 However, proNGF can also mediate survival. Rattenholl et al. have shown that proNGF was as effective as NGF in inducing survival of DRG neurons.3 Fahnestock et al. have shown that a mutated proNGF exhibits neurite outgrowth on both PC12 cells and mouse sympathetic cervical ganglions.6A neccesary but not sufficient partner for proNGF is sortilin, a 95 kDa member of the Vps10p domain receptor family which is expressed in a variety of tissues, notably brain, spinal tissue and muscle. However, not all cells expressing p75NTR and sortilin react to proNGF by becoming apoptotic. For example, in mature pig oligodendrocytes, which express p75NTR and sortilin, proNGF induces survival.7A close analysis of the literature shows that there are at least four types of proNGF which have been used in biological assays. One, produced in mammalian cell culture, contains two mutations at the furin cleavage site, two mutations at the C-terminus, and the addition of a C-terminal His tag.5 A second proNGF, produced in baculovirus, has only one mutation, at the cleavage site.6 A third proNGF has been purified from the brains of Alzheimer's patients, and is highly glycosylated.8 A fourth, with no mutations, has been expressed and purified from E.coli.3 The large variation between results obtained may be due to the different types of preparations assayed. Another crucial issue is the cell type and origin. Even in cells of the same type, for example, in oligodendrocytes: opposing effects of proNGF were seen in rat oligodendrocytes where it caused apoptosis, 9 however, in pig oligodendrocytes it induced survival.7 It should be noted that rat and pig oligodendrocytes do not express the same panel of receptors: rat oligodendrocytes do not express TrkA whereas pig (and human) oligodendrocytes do.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 5 ug
Available: In stock
available

Delivery expected until 1/8/2026 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close