Comparison

human Artemin European Partner

Item no. ALO-RPA-100-5ug
Manufacturer Alomone
Amount 5 ug
Quantity options 0.1 mg 0.25 mg 0.5 mg 10 ug 1 mg 25 ug 5 ug
Category
Type Proteins Recombinant
Format Lyophilized
Applications WB
Specific against other
Purity ≥98% (HPLC)
Formula Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Sequence AGGPGSRARAAGARGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Shipping Condition Room temperature
Available
Manufacturer - Type
Non Antibodies
Manufacturer - Category
Proteins
Manufacturer - Targets
GFRa3
Country of Origin
Israel
Shipping Temperature
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Storage Conditions
Storage as Solution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. - Storage before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. - Storage after Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Molecular Weight
23.9 kDa (dimer)
Manufacturer - Format
Lyophilized
Short description
Human Artemin, Recombinant,  E. coli
Description
Enovin, Neublastin - Human Artemin, Recombinant, E. coli
Reconstitution
Centrifuge the vial (10, 000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. Repeated freeze-thaw cycles may result in loss of activity.
Specificity

Human Artemin, Recombinant, E. coli

PH
7, 4
UNSPSC
12352202
Modifications
Inter-chain disulfide bonds between Cys16-Cys81, Cys43-Cys109, Cys47-Cys111 and intra-chain disulfide bond between Cys80 of two hArtemin molecules.
Effective Concentration
0.1 - 10 nM
Activity
Artemin supports the survival of different peripheral neurons and dopaminergic midbrain neurons both in vitro and in vivo. In addition, it supports motor neurons in culture1-3.
Solubility
Centrifuge the vial before adding solvent (10, 000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. Repeat freeze-thawing may result in loss of activity.
Sterile endotoxin free
yes
Bioassay tested
yes
Endotoxin level
<0.1 EU per 1 µg of the protein by the LAL method.
Scientific Background
Artemin (ART), also named enovin and neublastin, is a neurotrophic factor that is crucial for the proper development of the sympathetic nervous systeM ART belongs to the glial cell line-derived neurotrophic factor (GDNF) family of ligands, which also includes GDNF, neurturin (NRTN), and persephin (PSPN). Artemin mRNA is expressed in many human adult and fetal tissues and in rat Schwann cells. Artemin's activity is mediated by a receptor complex composed of a receptor tyrosine kinase signaling component, RET, which is common for all GFLs, and a specific anchored membrane protein, GFRα3. Experimental studies have suggested that artemin supports the survival of cultured neurons from the dorsal root, trigeminal, nodose, and superior cervical ganglia and that it affects neurite outgrowth from the dorsal root and sympathetic ganglia of murine embryos. Recent investigations have reported that systemic artemin prevents and reverses neuropathic pain1.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 5 ug
Available: In stock
available

Delivery expected until 1/8/2026 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close