« Back
Home /
Recombinant Human Cyclic nucleotide-gated cation channel alpha-4 (CNGA4)

Recombinant Human Cyclic nucleotide-gated cation channel alpha-4 (CNGA4)

Manufacturer	Biomatik
Category	Neuroscience Protein Aggregation, Clearance & Misfolding Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human
Amount	100ug
Item no.	BM-RPC20810-100ug
Targets	IGBP1
eClass 6.1	34160400
eClass 9.0	42020190
Available
Gene Name	CNGA4
Alternative Names	Cyclic nucleotide-gated channel alpha-4 Short name: CNG channel alpha-4 Short name: CNG-4 Short name: CNG4
Uniprot	Q8IV77
Source	in vitro E.coli expression system
Expression Region	1-575aa
AA Sequence	MSQDTKVKTTESSPPAPSKARKLLPVLDPSGDYYY WWLNTMVFPVMYNLIILVCRACFPDLQHGYLVAWL VLDYTSDLLYLLDMVVRFHTGFLEQGILVVDKGRI SSRYVRTWSFFLDLASLMPTDVVYVRLGPHTPTLR LNRFLRAPRLFEAFDRTETRTAYPNAFRIAKLMLY IFVVIHWNSCLYFALSRYLGFGRDAWVYPDPAQPG FERLRRQYLYSFYFSTLILTTVGDTPPPAREEEYL FMVGDFLLAVMGFATIMGSMSSVIYNMNTADAAFY PDHALVKKYMKLQHVNRKLERRVIDWYQHLQINKK MTNEVAILQHLPERLRAEVAVSVHLSTLSRVQIFQ NCEASLLEELVLKLQPQTYSPGEYVCRKGDIGQEM YIIREGQLAVVADDGITQYAVLGAGLYFGEISIIN IKGNMSGNRRTANIKSLGYSDLFCLSKEDLREVLS EYPQAQTIMEEKGREILLKMNKLDVNAEAAEIALQ EATESRLRGLDQQLDDLQTKFARLLAELESSALKI AYRIERLEWQTREWPMPEDLAEADDEGEPEEGTSK DEEGRASQEGPPGPE
Sequence Info	Full Length
Tag Info	N-terminal 6xHis-SUMO-tagged
Theoretical MW	82 kDa
Purity	>90% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Second messenger, cAMP, causes the opening of cation-selective cyclic nucleotide-gated (CNG) channels and depolarization of the neuron (olfactory sensory neurons, OSNs). CNGA4 is the modulatory subunit of this channel which is known to play a central role in the transduction of odorant signals and subsequent adaptation. By accelerating the calcium-mediated negative feedback in olfactory signaling it allows rapid adaptation to odor stimulation and extends its range of odor detection (By similarity).
Function	Second messenger, cAMP, causes the opening of cation-selective cyclic nucleotide-gated (CNG) channels and depolarization of the neuron (olfactory sensory neurons, OSNs). CNGA4 is the modulatory subunit of this channel which is known to play a central role in the transduction of odorant signals and subsequent adaptation. By accelerating the calcium-mediated negative feedback in olfactory signaling it allows rapid adaptation to odor stimulation and extends its range of odor detection (By similarity).
Subcellular location	Membrane, Multi-pass membrane protein
Protein Families	Cyclic nucleotide-gated cation channel (TC 1.A.1.5) family, CNGA4 subfamily
Paythway	cAMPsignalingpathway

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Delivery expected until 6/27/2024