Comparison

Recombinant Human TIR domain-containing adapter molecule 1(TICAM1)

Item no. CSB-CF811598HUe1-20
Manufacturer Cusabio
Amount 20 ug
Quantity options 10 ug 100 ug 20 ug 50 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MACTGPSLPSAFDILGAAGQDKLLYLKHKLKTPRP GCQGQDLLHAMVLLKLGQETEARISLEALKADAVA RLVARQWAGVDSTEDPEEPPDVSWAVARLYHLLAE EKLCPASLRDVAYQEAVRTLSSRDDHRLGELQDEA RNRCGWDIAGDPGSIRTLQSNLGCLPPSSALPSGT RSLPRPIDGVSDWSQGCSLRSTGSPASLASNLEIS QSPTMPFLSLHRSPHGPSKLCDDPQASLVPEPVPG GCQ
Citations TICAM-1, an adapter molecule that participates in Toll-like receptor 3 mediated interferon-beta induction.Oshiumi H., Matsumoto M.,Funami K., Akazawa T., Seya T.Nat. Immunol. 4:161-167(2003)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Proline-rich, vinculin and TIR domain-containing protein B; Putative NF-kappa-B-activating protein 502H; Toll-interleukin-1 receptor domain-containing adapter protein inducing interferon beta
Available
Manufacturer - Conjugate / Tag
Tag-Free
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
76.4 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas
Immunology
Relevance
Involved in innate immunity against invading pathogens. Adapter used by TLR3 and TLR4 (through TICAM2) to mediate NF-kappa-B and interferon-regulatory factor (IRF) activation, and to induce apoptosis. Ligand binding to these receptors results in TRIF recruitment through its TIR domain. Distinct protein-interaction motifs allow recruitment of the effector proteins TBK1, TRAF6 and RIPK1, which in turn, lead to the activation of transcription factors IRF3 and IRF7, NF-kappa-B and FADD respectively.
Expression Region
1-712aa
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Involved in innate immunity against invading pathogens. Adapter used by TLR3 and TLR4 (through TICAM2) to mediate NF-kappa-B and interferon-regulatory factor (IRF) activation, and to induce apoptosis. Ligand binding to these receptors results in TRIF recruitment through its TIR domain. Distinct protein-interaction motifs allow recruitment of the effector proteins TBK1, TRAF6 and RIPK1, which in turn, lead to the activation of transcription factors IRF3 and IRF7, NF-kappa-B and FADD respectively.
Subcellular Location
Cytoplasmic vesicle, autophagosome
Tissue Specificity
Ubiquitously expressed but with higher levels in liver.
Involvement in disease
Herpes simplex encephalitis 4 (HSE4)
Paythway
NF-kappaBsignalingpathway
Gene Names
TICAM1
Sequence Info
Full Length
Organism
Homo sapiens(Human)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close