« Back
Home /
Recombinant Human Vesicle-associated membrane protein 2(VAMP2)

Recombinant Human Vesicle-associated membrane protein 2(VAMP2)

Manufacturer	Cusabio
Category	Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins Neurodegeneration Markers;Research Area Neural Signaling
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	20ug
Host	E.coli
Item no.	CSB-EP025781HU-20
Conjugate/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Areas	Cancer
Uniprot ID	P63027
Gene Names	VAMP2
Organism	Homo sapiens (Human)
AA Sequence	MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQT QAQVDEVVDIMRVNVDKVLERDQKLSELDDRADAL QAGASQFETSAAKLKRKYWWKNLKMMIILGVICAI ILIIIIVYFST
Expression Region	1-116aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	39.7 kDa
Alternative Name(s)	Synaptobrevin-2
Relevance	Involved in the targeting and/or fusion of transport vesicles to their target membrane. Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1.
Reference	The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).The MGC Project Team Genome Res. 14:2121-2127(2004)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Involved in the targeting and/or fusion of transport vesicles to their target membrane. Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1.
Subcellular Location	Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane, Single-pass type IV membrane protein, Cell junction, synapse, synaptosome, Cell membrane
Protein Families	Synaptobrevin family
Tissue Specificity	Nervous system and skeletal muscle.
Paythway	SecretedExtracellularVesicles
Tag Information	N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20ug

available

Request delivery time