Comparison

Recombinant Canine coronavirus Nucleoprotein(N)

Item no. CSB-EP312949CCP-1mg
Manufacturer Cusabio
Amount 1 mg
Quantity options 100 ug 1 mg 20 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against Dog (Canine, Canis lupus familiaris)
Conjugate/Tag HIS
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MANQGQRVQWGVDITKKRGLSNSRGRKNNTIPLSFFNPITLQQGSKFWNLCPRDFVPKGIGNKDQQIGYWNRQSRYRMVKGQRKELPERWFFYYLGTGPHADAKFKDRIDGVVWVAKDGAMNKPTTLGNRGANNESKALKFDGKVPGEFQLEVNQSRDNSRSPSQSRSQSRNRSQSRGRQQSNNKKDDSVEQAVLAALKKLGVDTEKQQQRSRSKSKERSNSKTRDTTPKNENKHTWKRTAGKGDVTKFYGARSS
Citations Genomic organization and expression of the 3' end of the canine and feline enteric coronaviruses.' Vennema H., Rossen J.W.A., Wesseling J., Horzinek M.C., Rottier P.J.M. Virology 191:134-140(1992)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias (Nucleocapsid protein)(NC)(Protein N)
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Molecular Weight
49.3 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Relevance
Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication.
Expression Region
1-382aa
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Gene Names
Q04700
Sequence Info
Full Length
Endotoxin
Not test.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close