Comparison

Recombinant Murine polyomavirus Major capsid protein VP1

Item no. CSB-EP326154MKKc7-100ug
Manufacturer Cusabio
Amount 100 ug
Quantity options 100 ug 1 mg 20 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against Mouse (Murine, Mus musculus)
Conjugate/Tag HIS
Purity Greater than 85% as determined by SDS-PAGE.
Sequence APTVKKRTSQNQGLSPQKSQNSVVVGGIQVLDVRTGPDSITQIEAFLNPRMGKPVDSDFYGFSDNITVSADYTQDMPRIKELPCYSMAKISLPMLNEDMTCDTILMWEAISCKTEVVGVSSLTNCHSAVKRLYDNEGAGFPVQGLNFHFFSVGGEALDLQWLWKNYRCNYPAGVAALQAAPKAAQVLDPKLKAKLTADGKFPIEAWSPDPAKNENTRYFGTYTGGLQTPPVLQITNTTTTILLNENGVGPLCKGD
Citations The Polyomaviridae: Contributions of virus structure to our understanding of virus receptors and infectious entry.' Neu U., Stehle T., Atwood W.J. Virology 384:389-399(2009)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Major capsid protein VP1(Major structural protein VP1)
Available
Manufacturer - Conjugate / Tag
C-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Molecular Weight
42.4 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Relevance
Forms an icosahedral capsid with a T=7 symmetry and a 40 nm diameter. The capsid is composed of 72 pentamers linked to each other by disulfide bonds and associated with VP2 or VP3 proteins. Interacts with terminal alpha(2, 3)-linked sialic acids on the cell surface to provide virion attachment to target cell. This attachment induces virion internalization predominantly through caveolin-mediated endocytosis. Once attached, the virion is internalized by caveolin-mediated endocytosis and traffics to the endoplasmic reticulum. Inside the endoplasmic reticulum, the protein folding machinery isomerizes VP1 interpentamer disulfide bonds, thereby triggering initial uncoating. Next, the virion uses the endoplasmic reticulum-associated degradation machinery to probably translocate in the cytosol before reaching the nucleus. Nuclear entry of the viral DNA involves the selective exposure and importin recognition of VP2/Vp3 nuclear localization signal. In late phase of infection, neo-synthesized VP1 encapsulates replicated genomic DNA in the nucleus, and participates in rearranging nucleosomes around the viral DNA.
Expression Region
2-373aa
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Sequence Info
Full Length of Mature Protein
Endotoxin
Not test.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close