Comparison

Recombinant Saccharomyces cerevisiae Probable tRNA threonylcarbamoyladenosine biosynthesis protein KAE1(KAE1)

Item no. CSB-EP330543SVG-20
Manufacturer Cusabio
Amount 20 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Conjugate/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MVNLNTIPPKNGRDYYIALGLEGSANKLGVGIVKH PLLPKHANSDLSYDCEAEMLSNIRDTYVTPPGEGF LPRDTARHHRNWCIRLIKQALAEADIKSPTLDIDV ICFTKGPGMGAPLHSVVIAARTCSLLWDVPLVGVN HCIGHIEMGREITKAQNPVVLYVSGGNTQVIAYSE KRYRIFGETLDIAIGNCLDRFARTLKIPNEPSPGY NIEQLAKKAPHKENLVELPYTVKGMDLSMSGILAS IDL
Protein Family KAE1 / TsaD family
Citations Sequencing and comparison of yeast species to identify genes and regulatory elements.Kellis M., Patterson N., Endrizzi M., Birren B.W., Lander E.S.Nature 423:241-254(2003)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Kinase-associated endopeptidase 1; N6-L-threonylcarbamoyladenine synthase; Short name:; t(6)A synthase; t(6)A37 threonylcarbamoyladenosine biosynthesis protein KAE1; tRNA threonylcarbamoyladenosine biosynthesis protein KAE1
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
46.7 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Relevance
Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t6A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. KAE1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators.
Expression Region
1-386aa
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. KAE1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators.
Subcellular Location
Cytoplasm, Nucleus
Gene Names
KAE1
Sequence Info
Full Length
Organism
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close