« Back
Home /
Recombinant Listeria monocytogenes serovar 1/2a 1-phosphatidylinositol phosphodiesterase(plcA)

Recombinant Listeria monocytogenes serovar 1/2a 1-phosphatidylinositol phosphodiesterase(plcA)

Item no.	CSB-EP341477LPY-20
Manufacturer	Cusabio
Amount	20 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	FPLGGKAYSLNNWNKPIKNSVTTKQWMSALPDTTN LAALSIPGTHDTMSYNGDITWTLTKPLAQTQTMSL YQQLEAGIRYIDIRAKDNLNIYHGPIFLNASLSGV LETITQFLKKNPKETIIMRLKDEQNSNDSFDYRIQ PLINIYKDYFYTTPRTDTSNKIPTLKDVRGKILLL SENHTKKPLVINSRKFGMQFGAPNQVIQDDYNGPS VKTKFKEIVQTAYQASKADNKLFLNHISATSLTFT PRQ
Citations	Detection of a gene encoding a phosphatidylinositol-specific phospholipase C that is co-ordinately expressed with listeriolysin in Listeria monocytogenes. Leimeister-Waechter M., Domann E., Chakraborty T. Mol. Microbiol. 5:361-366(1991)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Phosphatidylinositol diacylglycerol-lyase; Phosphatidylinositol-specific phospholipase C
Available
Manufacturer - Conjugate / Tag	Tag-Free
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	33.5 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Relevance	Cleaves glycosylphosphatidylinositol (GPI) and phosphatidylinositol (PI) anchors but not PI phosphates. Important factor in pathogenesis, PI-PLC activity is present only in virulent listeria species. It may participate in the lysis of the phagolysosomal membrane.
Expression Region	23-317aa
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Cleaves glycosylphosphatidylinositol (GPI) and phosphatidylinositol (PI) anchors but not PI phosphates. Important factor in pathogenesis, PI-PLC activity is present only in virulent listeria species. It may participate in the lysis of the phagolysosomal membrane.
Subcellular Location	Secreted, Cytoplasm
Gene Names	plcA
Sequence Info	Full Length of Mature Protein
Organism	Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP341477LPY-20-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer