« Back
Home /
Recombinant Escherichia coli O6:H1 Cell division protein FtsZ(ftsZ)

Recombinant Escherichia coli O6:H1 Cell division protein FtsZ(ftsZ)

Item no.	CSB-EP359270EGX-20
Manufacturer	Cusabio
Amount	20 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIE GVEFFAVNTDAQALRKTAVGQTIQIGSGITKGLGA GANPEVGRNAADEDRDALRAALEGADMVFIAAGMG GGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGK KRMAFAEQGITELSKHVDSLITIPNDKLLKVLGRG ISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDF ADVRTVMSEMGYAMMGSGVASGEDRAEEAAEMAIS SPL
Protein Family	FtsZ family
Citations	Extensive mosaic structure revealed by the complete genome sequence of uropathogenic Escherichia coli.Welch R.A., Burland V., Plunkett G. III, Redford P., Roesch P., Rasko D., Buckles E.L., Liou S.-R., Boutin A., Hackett J., Stroud D., Mayhew G.F., Rose D.J., Zhou S., Schwartz D.C., Perna N.T., Mobley H.L.T., Donnenberg M.S., Blattner F.R.Proc. Natl. Acad. Sci. U.S.A. 99:17020-17024(2002)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Manufacturer - Targets	ftsZ
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	56.3 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Relevance	Essential cell division protein that forms a contractile ring structure (Z ring) at the future cell division site. The regulation of the ring assbly controls the timing and the location of cell division. One of the functions of the FtsZ ring is to recruit other cell division proteins to the septum to produce a new cell wall between the dividing cells. Binds GTP and shows GTPase activity.
Biologically Active	Not Test
Expression Region	1-383aa
Protein Length	Full Length
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Essential cell division protein that forms a contractile ring structure (Z ring) at the future cell division site. The regulation of the ring assembly controls the timing and the location of cell division. One of the functions of the FtsZ ring is to recruit other cell division proteins to the septum to produce a new cell wall between the dividing cells. Binds GTP and shows GTPase activity.
Subcellular Location	Cytoplasm

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP359270EGX-20-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ug

available

Delivery expected until 10/23/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer