Comparison

Recombinant Human Progesterone-induced-blocking factor 1(PIBF1)

Item no. CSB-EP845171HU-20
Manufacturer Cusabio
Amount 20 ug
Quantity options 1 mg 100 ug 20 ug
Category
Type Proteins Recombinant
Specific against other
Conjugate/Tag Myc, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MSRKISKESKKVNISSSLESEDISLETTVPTDDIS SSEEREGKVRITRQLIERKELLHNIQLLKIELSQK TMMIDNLKVDYLTKIEELEEKLNDALHQKQLLTLR LDNQLAFQQKDASKYQELMKQEMETILLRQKQLEE TNLQLREKAGDVRRNLRDFELTEEQYIKLKAFPED QLSIPEYVSVRFYELVNPLRKEICELQVKKNILAE ELSTNKNQLKQLTETYEEDRKNYSEVQIRCQRLAL ELA
Citations Molecular cloning and immunologic characterization of a novel cDNA coding for progesterone-induced blocking factor.
Polgar B., Kispal G., Lachmann M., Paar C., Nagy E., Csere P., Miko E., Szereday L., Varga P., Szekeres-Bartho J., Paar G.
J. Immunol. 171:5956-5963(2003)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias PIBF (Centrosomal protein of 90 kDa) (CEP90) (C13orf24) (PIBF)
Available
Manufacturer - Conjugate / Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
97.2 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas
Cell Biology
Relevance
Isoform 1: Pericentriolar protein required to maintain mitotic spindle pole integrity. Required for the centrosomal accumulation of PCM1 and the recruitment of centriolar satellite proteins such as BBS4. Via association with PCM1 may be involved in primary cilia formation. Required for CEP63 centrosomal localization and its interaction with WDR62. Together with CEP63 promotes centriole duplication. Promotes the centrosomal localization of CDK2 .
Expression Region
1-757aa
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Gene Names
PIBF1
Sequence Info
Full Length
Organism
Homo sapiens (Human)
Manufacturer - Format
Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close