Comparison

Recombinant Human Heat-stable enterotoxin receptor(GUCY2C),partial

Item no. CSB-MP010053HU-500
Manufacturer Cusabio
Amount 500 ug
Quantity options 10 ug 100 ug 1 mg 20 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Host Mammalian cells
Conjugate/Tag HIS
Purity Greater than 95% as determined by SDS-PAGE.
Sequence SQVSQNCHNGSYEISVLMMGNSAFAEPLKNLEDAV NEGLEIVRGRLQNAGLNVTVNATFMYSDGLIHNSG DCRSSTCEGLDLLRKISNAQRMGCVLIGPSCTYST FQMYLDTELSYPMISAGSFGLSCDYKETLTRLMSP ARKLMYFLVNFWKTNDLPFKTYSWSTSYVYKNGTE TEDCFWYLNALEASVSYFSHELGFKVVLRQDKEFQ DILMDHNRKSNVIIMCGGPEFLYKLKGDRAVAEDI VII
Protein Family Adenylyl cyclase class-4/guanylyl cyclase family
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Guanylyl cyclase C (GC-C) (Intestinal guanylate cyclase) (GUC2C) (STAR)
Available
Manufacturer - Conjugate / Tag
N-terminal 10xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
49.5 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas
Metabolism
Relevance
Receptor for the E.coli heat-stable enterotoxin (E.coli enterotoxin markedly stimulates the accumulation of cGMP in mammalian cells expressing GC-C). Also activated by the endogenous peptides guanylin and uroguanylin.
Expression Region
24-430aa
Protein Length
Extracellular Domain
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Receptor for the E.coli heat-stable enterotoxin (E.coli enterotoxin markedly stimulates the accumulation of cGMP in mammalian cells expressing GC-C). Also activated by the endogenous peptides guanylin and uroguanylin.
Subcellular Location
Cell membrane, Single-pass type I membrane protein, Endoplasmic reticulum membrane, Single-pass type I membrane protein
Involvement in disease
Diarrhea 6 (DIAR6); Meconium ileus (MECIL)
Biological activity
Not Test
Manufacturer - Format
Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 ug
Available: In stock
available

Delivery expected until 1/8/2026 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close