Comparison

Recombinant Human Polypyrimidine tract-binding protein 1(PTBP1)

Item no. CSB-MP018948HU-500
Manufacturer Cusabio
Amount 500 ug
Quantity options 10 ug 100 ug 1 mg 20 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Specific against other
Host Mammalian cells
Conjugate/Tag HIS
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MDGIVPDIAVGTKRGSDELFSTCVTNGPFIMSSNS ASAANGNDSKKFKGDSRSAGVPSRVIHIRKLPIDV TEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEE AANTMVNYYTSVTPVLRGQPIYIQFSNHKELKTDS SPNQARAQAALQAVNSVQSGNLALAASAAAVDAGM AMAGQSPVLRIIVENLFYPVTLDVLHQIFSKFGTV LKIITFTKNNQFQALLQYADPVSAQHAKLSLDGQN IYN
Citations Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias 57 kDa RNA-binding protein PPTB-1 (Heterogeneous nuclear ribonucleoprotein I) (hnRNP I) (PTB) (PTB)
Available
Manufacturer - Conjugate / Tag
N-terminal 10xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
63.1 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas
Epigenetics and Nuclear Signaling
Relevance
Plays a role in pre-mRNA splicing and in the regulation of alternative splicing events. Activates exon skipping of its own pre-mRNA during muscle cell differentiation. Binds to the polypyrimidine tract of introns. May promote RNA looping when bound to two separate polypyrimidine tracts in the same pre-mRNA. May promote the binding of U2 snRNP to pre-mRNA. Cooperates with RAVER1 to modulate switching between mutually exclusive exons during maturation of the TPM1 pre-mRNA. Represses the splicing of MAPT/Tau exon 10. In case of infection by picornaviruses, binds to the viral internal ribosome entry site and stimulates the IRES-mediated translation.
Expression Region
1-557aa
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Plays a role in pre-mRNA splicing and in the regulation of alternative splicing events. Activates exon skipping of its own pre-mRNA during muscle cell differentiation. Binds to the polypyrimidine tract of introns. May promote RNA looping when bound to two separate polypyrimidine tracts in the same pre-mRNA. May promote the binding of U2 snRNP to pre-mRNA. Cooperates with RAVER1 to modulate switching between mutually exclusive exons during maturation of the TPM1 pre-mRNA. Represses the splicing of MAPT/Tau exon 10
Subcellular Location
Nucleus
Gene Names
PTBP1
Sequence Info
Full Length of Isoform
Organism
Homo sapiens (Human)
Manufacturer - Format
Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close