« Back
Home /
Recombinant Human P-selectin(SELP),partial

Recombinant Human P-selectin(SELP),partial

Item no.	CSB-MP020978HU-500ug
Manufacturer	Cusabio
Amount	500 ug
Quantity options	100 ug 1 mg 20 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	Human (Homo sapiens)
Conjugate/Tag	Myc
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	WTYHYSTKAYSWNISRKYCQNRYTDLVAIQNKNEIDYLNKVLPYYSSYYWIGIRKNNKTWTWVGTKKALTNEAENWADNEPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVRECGELELPQHVLMNCSHPLGNFSFNSQCSFHCTDGYQVNGPSKLECLASGIWTNKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCSFSCEEGF
Citations	Glycan Bound to the Selectin Low Affinity State Engages Glu-88 to Stabilize the High Affinity State under Force.' Mehta-D'souza P., Klopocki A.G., Oganesyan V., Terzyan S., Mather T., Li Z., Panicker S.R., Zhu C., McEver R.P. J. Biol. Chem. 292:2510-2518(2017)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CD62 antigen-like family member P;Granule membrane protein 140;GMP-140;Leukocyte-endothelial cell adhesion molecule 3;LECAM3;Platelet activation dependent granule-external membrane protein;PADGEM;CD62P
Available
Manufacturer - Conjugate / Tag	C-terminal hFc-Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Molecular Weight	108.8 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Relevance	Ca2+-dependent receptor for myeloid cells that binds to carbohydrates on neutrophils and monocytes. Mediates the interaction of activated endothelial cells or platelets with leukocytes. The ligand recognized is sialyl-Lewis X. Mediates rapid rolling of leukocyte rolling over vascular surfaces during the initial steps in inflammation through interaction with SELPLG.
Expression Region	42-771aa
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Gene Names	SELP
Sequence Info	Partial
Endotoxin	Not test.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-MP020978HU-500ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 ug

available

Delivery expected until 9/4/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer