« Back
Home /
Recombinant Macaca fascicularis Trophoblast glycoprotein(TPBG),partial

Recombinant Macaca fascicularis Trophoblast glycoprotein(TPBG),partial

Item no.	CSB-MP024093MOV-1
Manufacturer	Cusabio
Amount	1 mg
Quantity options	1 mg 10 ug 100 ug 20 ug 50 ug
Category	Oncology Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins By Organ Testicular & Prostate Cancer
Type	Proteins Recombinant
Specific against	other
Conjugate/Tag	Myc, HIS
Purity	Greater than 95% as determined by SDS-PAGE.
Sequence	TSSASSSSSSAPFLASAASAQPPLPDQCPALCECS EAARTVKCVNRNLTEVPTDLPLYVRNLFLTGNQLA VLPAGAFARRPPLAELAALNLSGSRLDEVRGGAFE HLPSLRQLDLSHNPLAYLSPFAFSGSNASISAPSP LVELILNHIVPPDDKRQNRSFEGMVAAALVAGRAL QGLHLLELASNHFLYLPRDVLAQLPSLRYLDLSNN SLVSLTYVSFRNLTHLESLHLEDNALKVLHNGTLA ELQ
Citations	DNA sequences of macaque genes expressed in brain or testis and its evolutionary implications. International consortium for macaque cDNA sequencing and analysis Submitted (JUN-2005)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Wnt-activated inhibitory factor 1,WAIF1
Available
Manufacturer - Type	Protein
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	39.9 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Relevance	May function as an inhibitor of Wnt/beta-catenin signaling by indirectly interacting with LRP6 and blocking Wnt3a-dependent LRP6 internalization.
Expression Region	35-355aa
Protein Length	Partial
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May function as an inhibitor of Wnt/beta-catenin signaling by indirectly interacting with LRP6 and blocking Wnt3a-dependent LRP6 internalization.
Subcellular Location	Cell membrane, Single-pass type I membrane protein
Gene Names	TPBG
Sequence Info	Extracellular Domain
Organism	Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Manufacturer - Format	Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-MP024093MOV-1-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 11/27/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer