« Back
Home /
Recombinant Mouse Low affinity immunoglobulin gamma Fc region receptor III(Fcgr3),partial

Recombinant Mouse Low affinity immunoglobulin gamma Fc region receptor III(Fcgr3),partial

Item no.	CSB-MP357412MO-500
Manufacturer	Cusabio
Amount	500 ug
Quantity options	10 ug 100 ug 1 mg 20 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Host	Mammalian cells
Conjugate/Tag	Myc, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	ALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNS STQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQM EQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITL RCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPK ANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATT SSISLVWYHT
Citations	SH2-containing inositol phosphatase (SHIP-1) transiently translocates to raft domains and modulates CD16-mediated cytotoxicity in human NK cells.Galandrini R., Tassi I., Mattia G., Lenti L., Piccoli M., Frati L., Santoni A.Blood 100:4581-4589(2002)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Fc-gamma RIII,FcRIII,CD_antigen: CD16
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	25.2 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Relevance	Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor.
Expression Region	31-215aa
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor which binds to IgG1, IgG2a and IgG2b
Subcellular Location	Cell membrane, Single-pass type I membrane protein
Gene Names	Fcgr3
Sequence Info	Full Length of Mature Protein
Organism	Mus musculus (Mouse)
Manufacturer - Format	Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-MP357412MO-500-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 ug

available

Delivery expected until 11/20/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer