« Back
Home /
Recombinant Human UL16-binding protein 1(ULBP1) (Active)

Recombinant Human UL16-binding protein 1(ULBP1) (Active)

Item no.	CSB-MP887177HU-20
Manufacturer	Cusabio
Amount	20 ug
Quantity options	100 ug 1 mg 20 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Mammalian cells
Conjugate/Tag	Myc
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPG
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	(ALCAN-beta) (NKG2D ligand 1) (N2DL-1) (NKG2DL1) (Retinoic acid early transcript 1I)
Available
Manufacturer - Type	Protein
Manufacturer - Conjugate / Tag	C-terminal hFc-Myc-tagged
Molecular Weight	52.4 kDa
Buffer	Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.4
General Research Areas	Cancer
Relevance	Binds and activates the KLRK1/NKG2D receptor, mediating natural killer cell cytotoxicity.
Expression Region	26-216aa
Protein Length	Full Length of Mature Protein
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Gene Names	ULBP1
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Biological activity	?Measured by its binding ability in a functional ELISA. Immobilized KLRK1 (CSB-MP012474HU1) at 10 ug/ml can bind human ULBP1, the EC50 of human ULBP1 protein is 228.5-427.6 ng/ml. ?Human KLRK1 protein Fc tag (CSB-MP012474HU1) captured on COOH chip can bind Human ULBP1 protein Fc/myc tag (CSB-MP887177HU) with an affinity constant of 2.27 nM as detected by LSPR Assay.
Manufacturer - Format	Liquid or Lyophilized powder
Protein Description	Full Length of Mature Protein

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-MP887177HU-20-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ug

available

Delivery expected until 1/15/2026

Compare

Add to wishlist

Get an offer

Request delivery time