Comparison

Recombinant Human UL16-binding protein 1(ULBP1),Biotinylated (Active)

Item no. CSB-MP887177HUj1-B-20ug
Manufacturer Cusabio
Amount 20 ug
Quantity options 100 ug 1 mg 20 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Conjugate/Tag Avi
Purity Greater than 95% as determined by SDS-PAGE.
Sequence GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPG
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Available
Manufacturer - Type
Protein
Manufacturer - Conjugate / Tag
C-terminal mFc-Avi-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Molecular Weight
51, 3
Buffer
Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4
Expression Region
26-216aa
Protein Length
Full Length of Mature Protein
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Gene Names
ULBP1
Sequence Info
Full Length of Mature Protein
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological activity
Measured by its binding ability in a functional ELISA. Immobilized KLRK1 (CSB-MP012474HU1) at 10 ?g/ml can bind human Biotinylated ULBP1, the EC50 is 4.254-7.295 ng/ml.
Manufacturer - Format
Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ug
Available: In stock
available

Delivery expected until 1/15/2026 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close