Comparison

Recombinant Bovine Retinol-binding protein 3(RBP3),partial

Item no. CSB-YP019482BO-20
Manufacturer Cusabio
Amount 20 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Specific against other
Host Yeast
Conjugate/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence SLGELVEGTGRLLEAHYARPEVVGQMGALLRAKLA QGAYRTAVDLESLASQLTADLQEMSGDHRLLVFHS PGEMVAEEAPPPPPVVPSPEELSYLIEALFKTEVL PGQLGYLRFDAMAELETVKAVGPQLVQLVWQKLVD TAALVVDLRYNPGSYSTAVPLLCSYFFEAEPRRHL YSVFDRATSRVTEVWTLPHVTGQRYGSHKDLYVLV SHTSGSAAEAFAHTMQDLQRATIIGEPTAGGALSV GIY
Protein Family Peptidase S41A family
Citations Interphotoreceptor retinoid-binding protein. Gene characterization, protein repeat structure, and its evolution.Borst D.E., Redmond T.M., Elser J.E., Gonda M.A., Wiggert B., Chader G.J., Nickerson J.M.J. Biol. Chem. 264:1115-1123(1989)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Interphotoreceptor retinoid-binding protein ,IRBPInterstitial retinol-binding protein,Protein 7S
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
66.8 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Relevance
IRBP shuttles 11-cis and all trans retinoids between the retinol isomerase in the pigment epithelium and the visual pigments in the photoreceptor cells of the retina.
Expression Region
633-1231aa
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
IRBP shuttles 11-cis and all trans retinoids between the retinol isomerase in the pigment epithelium and the visual pigments in the photoreceptor cells of the retina.
Subcellular Location
Secreted, extracellular space, extracellular matrix, interphotoreceptor matrix
Gene Names
RBP3
Sequence Info
Partial
Organism
Bos taurus (Bovine)
Manufacturer - Format
Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close