« Back
Home /
Recombinant Streptococcus pneumoniae serotype 4 Pneumolysin(ply)

Recombinant Streptococcus pneumoniae serotype 4 Pneumolysin(ply)

Item no.	CSB-YP314690FMW-20
Manufacturer	Cusabio
Amount	20 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	ANKAVNDFILAMNYDKKKLLTHQGESIENRFIKEG NQLPDEFVVIERKKRSLSTNTSDISVTATNDSRLY PGALLVVDETLLENNPTLLAVDRAPMTYSIDLPGL ASSDSFLQVEDPSNSSVRGAVNDLLAKWHQDYGQV NNVPARMQYEKITAHSMEQLKVKFGSDFEKTGNSL DIDFNSVHSGEKQIQIVNFKQIYYTVSVDAVKNPG DVFQDTVTVEDLKQRGISAERPLVYISSVAYGRQV YLK
Protein Family	Thiol-activated cytolysin family
Citations	Complete genome sequence of a virulent isolate of Streptococcus pneumoniae.Tettelin H., Nelson K.E., Paulsen I.T., Eisen J.A., Read T.D., Peterson S.N., Heidelberg J.F., DeBoy R.T., Haft D.H., Dodson R.J., Durkin A.S., Gwinn M.L., Kolonay J.F., Nelson W.C., Peterson J.D., Umayam L.A., White O., Salzberg S.L. , Lewis M.R., Radune D., Holtzapple E.K., Khouri H.M., Wolf A.M., Utterback T.R., Hansen C.L., McDonald L.A., Feldblyum T.V., Angiuoli S.V., Dickinson T., Hickey E.K., Holt I.E., Loftus B.J., Yang F., Smith H.O., Venter J.C., Dougherty B.A., Morrison D.A., Hollingshead S.K., Fraser C.M.Science 293:498-506(2001)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Thiol-activated cytolysin
Available
Manufacturer - Targets	ply
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	54.8 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Relevance	Sulfhydryl-activated toxin that causes cytolysis by forming pores in cholesterol containing host mbranes. After binding to target mbranes, the protein undergoes a major conformation change, leading to its insertion in the host mbrane and formation of an oligomeric pore complex. Cholesterol may be required for binding to host mbranes, mbrane insertion and pore formation. Can be reversibly inactivated by oxidation .
Biologically Active	Not Test
Expression Region	2-471aa
Protein Length	Full Length of Mature Protein
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Sulfhydryl-activated toxin that causes cytolysis by forming pores in cholesterol containing host membranes. After binding to target membranes, the protein undergoes a major conformation change, leading to its insertion in the host membrane and formation of an oligomeric pore complex. Cholesterol may be required for binding to host membranes, membrane insertion and pore formation. Can be reversibly inactivated by oxidation (By similarity).
Subcellular Location	Secreted, Host cell membrane, Multi-pass membrane protein

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP314690FMW-20-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ug

available

Delivery expected until 9/4/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer