« Back
Home /
Recombinant Human IL-1RN Protein

Recombinant Human IL-1RN Protein

Item no.	RP00003-50ug
Manufacturer	Abclonal
Amount	50 ug
Quantity options	100 ug 200 ug 20 ug 50 ug
Category	Oncology Neuroscience Neuroinflammation Metabolism Diabetes By Cell Type Carcinoma Peptides & Proteins Recombinant Proteins Obesity
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 97% by SDS-PAGE.
Sequence	RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
NCBI	IL-1RN
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	DIRA,ICIL-1RA,IL-1RN,IL-1ra,IL-1ra3,IL1F3,IL1RA,IRAP,MVCD4,IL1RN,ICIL-1RA,IL-1RN,IL-1ra,IL-1ra3,IL1F3,IL1RA,IRAP,MVCD4
Similar products	IL1RA, IL-1RN, IL-1ra, IRAP, ICIL-1RA, IL1F3, DIRA, IL-1ra3, MVCD4
Shipping Condition	Cool pack
Available
Manufacturer - Applications	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	17.97 kDa
Manufacturer - Additional Information	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description	Recombinant Human IL-1RN Protein is produced by E. coli expression system. The target protein is expressed with sequence (Arg26-Glu177) of human IL-1RN (Accession #NP_776214.1) fused with an initial Met at the N-terminus and a 6×His tag at the C-terminus.
Background	Interleukin-1 receptor antagonist (IL-1RA) also known as IL1RN is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1, alpha (IL1A) and interleukin 1, beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses. A polymorphism of this protein is reported to be associated with increased risk of osteoporotic fractures and gastric cancer.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Arg26-Glu177
Route	C-His
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Research Area	Interleukin
Antigen Seq	RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human IL1RN at 10 μg/mL (100 μL/well) can bind Recombinant Human IL1R2 with a linear range of 0. 4-1. 8 μg/mL.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	17.97 kDa
Gene Symbol	IL-1RN

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP00003-50ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 10/2/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer