Comparison

Recombinant Human IL-6 Protein European Partner

Item no. RP00004-100ug
Manufacturer Abclonal
Amount 100 ug
Quantity options 100 ug 10 ug 20 ug 50 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 95% by SDS-PAGE.
Sequence PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
NCBI IL-6
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias IL6,BSF-2,BSF2,CDF,HGF,HSF,IFN-beta-2,IFNB2,IL-6
Similar products IL-6, HGF, IFNB2, BSF-2, CDF, IFN-beta-2, BSF2, HSF
Shipping Condition Cool pack
Available
Manufacturer - Category
Interleukin, Cell Culture related, Biosimilar Drug Targets
Shipping Temperature
ice pack
Storage Conditions
Store the lyophilized protein at -20°C to -80 °C for long term.
After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturer - Additional Information
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Recombinant Human IL-6 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Pro29-Met212) of human IL6 (Accession #NP_000591.1) fused with an initial Met at the N-terminus and a 6xHis tag at the C-terminus.
Background
Interleukin-6 (IL-6) is a multifunctional α-helical cytokine that regulates cell growth and differentiation of various tissues, which is known particularly for its role in the immune response and acute phase reactions. The encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with autoimmune diseases or infections. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this protein is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis.
Immunogen
Pro29-Met212
Route
C-His
Endotoxin
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Interleukin, Cell Culture related, Biosimilar Drug Targets
Bioactivity
1. Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human IL6R at 1 μg/mL (100 μL/well) can bind Recombinant Human IL-6 with a linear range of 20-70 ng/mL.|2. Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 0. 18-0. 74 ng/mL, corresponding to a specific activity of 1. 35x106~5. 55x106 units/mg..
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close