« Back
Home /
Recombinant Human PPIase A/PPIA Protein

Recombinant Human PPIase A/PPIA Protein

Item no.	RP00016-10ug
Manufacturer	Abclonal
Amount	10 ug
Quantity options	100 ug 10 ug 200 ug 20 ug 50 ug 5 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 97% by SDS-PAGE.
Sequence	MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
NCBI	PPIase A/PPIA
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	PPIA,CYPA,CYPH,HEL-S-69p
Similar products	CYPA, CYPH, HEL-S-69p
Shipping Condition	Cool pack
Available
Manufacturer - Applications	< 1.0 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	18.01 kDa
Manufacturer - Additional Information	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description	Recombinant Human PPIase A/PPIA Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Glu165) of human PPIA (Accession #NP_066953.1).
Background	This protein is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. The protein is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Met1-Glu165
Route	No tag
Endotoxin	< 1.0 EU/μg of the protein by LAL method.
Manufacturer - Research Area	Other Recombinant Protein
Antigen Seq	MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of 50mM Tris, 150mM NaCl, pH 8.0.Contact us for customized product form or formulation.
Expected Protein Size	18.01 kDa
Gene Symbol	PPIase A/PPIA

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP00016-10ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer