Comparison

Recombinant Human ERK2/MAPK1 Protein European Partner

Item no. RP00026-20ug
Manufacturer Abclonal
Amount 20 ug
Quantity options 10 ug 20 ug 50 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 70% by SDS-PAGE.
Sequence MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCI
NCBI ERK2/MAPK1
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias ERK,ERK-2,ERK2,ERT1,MAPK2,P42MAPK,PRKM1,PRKM2,p38,p40,p41,p41mapk,p42-MAPK,MAPK1
Similar products ERK2, ERK, MAPK2, PRKM2, p41mapk, p40, p38, PRKM1, ERT1, ERK-2, p42-MAPK, P42MAPK, p41
Shipping Condition Cool pack
Available
Manufacturer - Applications
Please contact us for more information.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
66.89 kDa
Manufacturer - Additional Information
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Recombinant Human ERK2/MAPK1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Ser360) of human MAPK1 (Accession #NP_002736.3) fused with a GST tag at the N-terminus.
Background
ERK2 is a protein serine/threonine kinase, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets. One study also suggests that this protein acts as a transcriptional repressor independent of its kinase activity. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Met1-Ser360
Route
N-GST
Manufacturer - Research Area
Other Recombinant Protein
Antigen Seq
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human MAPK1 (Catalog: RP00026LQ) at 1 μg/mL (100 μL/well) can bind ERK1/2 Rabbit mAb (Catalog: A4782) with a linear range of 0. 017-4. 92 ng/mL.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of 50mM Tris, 150mM NaCl, 0.1mM EDTA, 0.25mM DTT, 0.1mM AEBSF, pH8.0.Contact us for customized product form or formulation.
Expected Protein Size
66.89 kDa
Gene Symbol
ERK2/MAPK1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ug
Available: In stock
available

Delivery expected until 10/2/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close