Comparison

Recombinant Human Leptin/LEP Protein European Partner

Item no. RP00028-5ug
Manufacturer Abclonal
Amount 5 ug
Quantity options 10 ug 20 ug 50 ug 5 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 92% by SDS-PAGE.
NCBI Leptin/LEP
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias LEP,LEPD,OB,OBS,leptin
Similar products OB, OBS, LEPD
Shipping Condition Cool pack
Available
Manufacturer - Applications
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
16.03 kDa
Description
Recombinant Human Leptin/LEP Protein is produced by E. coli expression system. The target protein is expressed with sequence (Val22-Cys167) of human Leptin (Accession #NP_000221.1).
Background
Leptin is one of the most important hormones secreted by white adipocytes, and which plays a major role in the regulation of body weight. This protein, which acts through the leptin receptor, functions as part of a signaling pathway that can inhibit food intake and/or regulate energy expenditure to maintain constancy of the adipose mass. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis and wound healing. Mutations in this protein and/or its regulatory regions cause severe obesity, and morbid obesity with hypogonadism. This protein has also been linked to type 2 diabetes mellitus development.
Immunogen
Val22-Cys167
Route
No tag
Manufacturer - Research Area
Cytokines & Cytokine receptors
Revised name
LEPD, OB, OBS
Antigen Seq
VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human Leptin at 2 μg/mL (100 μL/well) can bind Recombinant Human Leptin R/CD295 with a linear range of 1. 22-261. 45 ng/mL.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of 50mM Tris, 150mM NaCl, pH 8.0.Contact us for customized product form or formulation.
Expected Protein Size
16.03 kDa
Gene Symbol
Leptin/LEP

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 5 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close