Comparison

Recombinant Human HTRA2 Protein European Partner

Item no. RP00041-20ug
Manufacturer Abclonal
Amount 20 ug
Quantity options 10 ug 20 ug 50 ug 5 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 92% by SDS-PAGE.
Sequence AVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQ
NCBI HTRA2
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias HTRA2,MGCA8,OMI,PARK13,PRSS25,OMI,PARK13,PRSS25
Similar products OMI, PRSS25, PARK13, MGCA8
Shipping Condition Cool pack
Available
Manufacturer - Applications
Please contact us for more information.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
34.98 kDa
Manufacturer - Additional Information
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Recombinant Human HTRA2 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala134-Glu458) of human HTRA2/Omi (Accession #NP_037379.1).
Background
The protein is a serine protease. It has been localized in the endoplasmic reticulum and interacts with an alternatively spliced form of mitogen-activated protein kinase 14. The protein has also been localized to the mitochondria with release to the cytosol following apoptotic stimulus. The protein is thought to induce apoptosis by binding the apoptosis inhibitory protein baculoviral IAP repeat-containing 4. Nuclear localization of this protein has also been observed.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Ala134-Glu458
Route
No tag
Manufacturer - Research Area
Other Recombinant Protein
Antigen Seq
AVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE
Bioactivity
Protease activity demonstrated by HtrA2 cleavage of bovine β-casein (Sigma, Catalog # C-6905). Incubation of β-casein at 0. 2 mg/mL with Recombinant Human HTRA-2 at 0. 02 mg/mL (ratio of 10:1) for 60 minutes at 45°C in 50 mM Tris, pH 8. 0, which results in >95% cleavage of β-casein, as revealed by SDS-PAGE.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.Contact us for customized product form or formulation.
Expected Protein Size
34.98 kDa
Gene Symbol
HTRA2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close