Comparison

Recombinant Human Apolipoprotein A-I/APOA1 Protein European Partner

Item no. RP00047-5ug
Manufacturer Abclonal
Amount 5 ug
Quantity options 100 ug 10 ug 20 ug 50 ug 5 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 95% by SDS-PAGE.
NCBI Apolipoprotein A-I/APOA1
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias apo(a),APOA1
Similar products apo(a)
Shipping Condition Cool pack
Available
Manufacturer - Applications
< 1.0 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
28.28 kDa
Description
Recombinant Human Apolipoprotein A-I/APOA1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Asp25-Gln267) of human Apolipoprotein A-I (Accession #NP_000030.1).
Background
This protein is the major protein component of high density lipoprotein (HDL) in plasma. The preproprotein is proteolytically processed to generate the mature protein, which promotes cholesterol efflux from tissues to the liver for excretion, and is a cofactor for lecithin cholesterolacyltransferase (LCAT), an enzyme responsible for the formation of most plasma cholesteryl esters.
Immunogen
Asp25-Gln267
Route
No tag
Manufacturer - Research Area
Other Recombinant Protein
Revised name
apo(a)
Antigen Seq
DEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
Bioactivity
Measured by its binding ability in a functional ELISA.Immobilized Mouse CD117 (Catalog: RP01519) at 5 μg/mL (100 μL/well) can bind Mouse SCF (Catalog: RP01055) with a linear range of 0. 01-2 ng/mL.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size
28.28 kDa
Gene Symbol
Apolipoprotein A-I/APOA1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 5 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close