« Back
Home /
Recombinant Human Oncostatin-M/OSM Protein

Recombinant Human Oncostatin-M/OSM Protein

Item no.	RP00054-100ug
Manufacturer	Abclonal
Amount	100 ug
Quantity options	100 ug 10 ug 20 ug 50 ug 5 ug
Category	Metabolism Diabetes Glucose Homeostasis Peptides & Proteins Recombinant Proteins Obesity
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 95% by SDS-PAGE.
Sequence	AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRR
NCBI	Oncostatin-M/OSM
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	OSM,oncostatin-M
Similar products	OSM, MGC20461, oncostatin-M, oncostatin M
Shipping Condition	Cool pack
Available
Manufacturer - Applications	< 0.01 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	22.15 kDa
Manufacturer - Additional Information	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description	Recombinant Human Oncostatin-M/OSM Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala26-Arg221) of human Oncostatin-M/OSM (Accession #NP_065391.1).
Background	This protein is a member of the leukemia inhibitory factor/oncostatin-M (LIF/OSM) family. The preproprotein is proteolytically processed to generate the mature protein. This protein is a secreted cytokine and growth regulator that inhibits the proliferation of a number of tumor cell lines. This protein also regulates the production of other cytokines, including interleukin 6, granulocyte-colony stimulating factor and granulocyte-macrophage colony stimulating factor in endothelial cells.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Ala26-Arg221
Route	No tag
Endotoxin	< 0.01 EU/μg of the protein by LAL method.
Manufacturer - Research Area	Cytokines & Cytokine receptors
Antigen Seq	AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRR
Bioactivity	Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED₅₀ for this effect is typically 0. 8-3. 2 ng/mL, corresponding to a specific activity of 3. 12×10⁵-1. 25×10⁶units/mg.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of 20mM Tris, 150mM NaCl, 5% glycerol, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	22.15 kDa
Gene Symbol	Oncostatin-M/OSM

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP00054-100ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 10/2/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer