Comparison

Recombinant Human Sonic hedgehog protein N-product/SHH(C24IVI) Protein European Partner

Item no. RP00056-5ug
Manufacturer Abclonal
Amount 5 ug
Quantity options 100 ug 10 ug 200 ug 20 ug 50 ug 5 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 97% by SDS-PAGE.
NCBI Sonic hedgehog
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias HHG1,HLP3,HPE3,MCOPCB5,SMMCI,TPT,TPTPS,SHH,HHG1,sonic hedgehog,HLP3,HPE3,MCOPCB5,SMMCI,TPT,TPTPS
Similar products TPT, HHG1, HLP3, HPE3, MCOPCB5, SMMCI, TPTPS
Shipping Condition Cool pack
Available
Manufacturer - Applications
< 1.0 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
19.78 kDa
Description
Recombinant Human Sonic hedgehog protein N-product/SHH(C24IVI) Protein is produced by E. coli expression system. The target protein is expressed with sequence (Cys24-Gly197 (Cys24Ile-Val-Ile)) of human Sonic hedgehog N-product (Accession #NP_000184.1).
Background
This protein is instrumental in patterning the early embryo. It has been implicated as the key inductive signal in patterning of the ventral neural tube, the anterior-posterior limb axis, and the ventral somites. Of three human proteins showing sequence and functional similarity to the sonic hedgehog protein of Drosophila, this protein is the most similar. The protein is made as a precursor that is autocatalytically cleaved; the N-terminal portion is soluble and contains the signalling activity while the C-terminal portion is involved in precursor processing. More importantly, the C-terminal product covalently attaches a cholesterol moiety to the N-terminal product, restricting the N-terminal product to the cell surface and preventing it from freely diffusing throughout the developing embryo. Defects in this protein or in its signalling pathway are a cause of holoprosencephaly (HPE), a disorder in which the developing forebrain fails to correctly separate into right and left hemispheres. HPE is manifested by facial deformities. It is also thought that mutations in this gene or in its signalling pathway may be responsible for VACTERL syndrome, which is characterized by vertebral defects, anal atresia, tracheoesophageal fistula with esophageal atresia, radial and renal dysplasia, cardiac anomalies, and limb abnormalities.
Immunogen
Cys24-Gly197(C24IVI)
Route
No tag
Manufacturer - Research Area
Cell Culture related
Revised name
HHG1, HLP3, HPE3, MCOPCB5, SMMCI, TPT, TPTPS
Antigen Seq
IVIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG
Bioactivity
Measured by its ability to inhibit p53 expression in C3H10T1/2 mouse embryonic fibroblast cells. 1. 25-2. 5 μg/mL of Recombinant Human Sonic hedgehog can effectively decrease p53 expression.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of 20mM Tris, 300mM NaCl, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size
19.78 kDa
Gene Symbol
Sonic hedgehog

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 5 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close