Comparison

Recombinant Human R-spondin-1/RSPO1 Protein European Partner

Item no. RP00071-10ug
Manufacturer Abclonal
Amount 10 ug
Quantity options 100 ug 10 ug 200 ug 20 ug 50 ug 5 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 95% by SDS-PAGE.
Sequence RISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA
NCBI R-spondin-1
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias RSPO1,CRISTIN3,RSPO
Shipping Condition Cool pack
Available
Manufacturer - Applications
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
26.44 kDa
Manufacturer - Additional Information
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Recombinant Human R-spondin-1/RSPO1 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Arg31-Ala263) of human R-Spondin1 (Accession #NP_001033722.1) fused with a 6×His tag at the C-terminus.
Background
This protein is a secreted activator protein with two cysteine-rich, furin-like domains and one thrombospondin type 1 domain. The encoded protein is a ligand for leucine-rich repeat-containing G-protein coupled receptors (LGR proteins) and positively regulates the Wnt signaling pathway. In mice, the protein induces the rapid onset of crypt cell proliferation and increases intestinal epithelial healing, providing a protective effect against chemotherapy-induced adverse effects.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Arg31-Ala263
Route
C-His
Endotoxin
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Cytokines & Cytokine receptors
Antigen Seq
RISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA
Bioactivity
1. Measured by its ability to enhance Cyclin D1 expression in HCT116 human colon adenocarcinoma cells. 0. 1-10ng/mL of Recombinant Human RSPO1 can effectively enhance Cyclin D1 expression.|2. The intestinal crypts of mice were cultured in organoid culture medium containing factor combinations (100 ng/mL Noggin, Cat. RP01237 + 500 ng/mL R-spindin-1, Cat. RP00071) derived from ABclonal for144 hours, intestinal organoids were formed. (Customer Feedback Data)|3. Recombinant Human R-Spondin 1 protein stimulated Wnt signal pathway with Wnt-3a protein in HEK293T cells. After 6 hours, the stimulation when adding 300 ng/mL of R-Spondin-1 reached highest effect. Compared with only Wnt-3a stimulation, the Wnt signaling pathway was enhanced 3. 1-fold after adding 300 ng/mL R-Spondin 1.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size
26.44 kDa
Gene Symbol
R-spondin-1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Delivery expected until 10/2/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close