« Back
Home /
Recombinant Human MMP-9 Protein

Recombinant Human MMP-9 Protein

Item no.	RP00103-5ug
Manufacturer	Abclonal
Amount	5 ug
Quantity options	100 ug 10 ug 200 ug 20 ug 500 ug 50 ug 5 ug
Category	Oncology Neuroscience Neuroinflammation Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 97% by SDS-PAGE.
NCBI	MMP-9
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	MMP9,CLG4B,GELB,MANDP2,MMP-9
Similar products	MMP-9, CLG4B, GELB, MANDP2
Shipping Condition	Cool pack
Available
Manufacturer - Applications	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	77.24 kDa
Description	Recombinant Human MMP-9 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala20-Asp707 (Q279R)) of human MMP-9/CLG4B (Accession #NP_004985.2) fused with a 6×His tag at the C-terminus.
Background	Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades type IV and V collagens. Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling.
Immunogen	Ala20-Asp707(Q279R)
Route	C-His
Manufacturer - Research Area	Biosimilar Drug Targets
Revised name	CLG4B, GELB, MANDP2, MMP-9
Antigen Seq	APRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTRDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED
Bioactivity	1. Measured in a cell migration assay using A549 cells. 1 ng/mL of Recombinant Human MMP-9 can effectively induce A549 cells migration. \|2. Recombinant Human MMP-9 Protein cleave the fluorogenic peptide substrate, Mca-PLGL-Dpa-AR-NH2 (Catalog # ES001). The specific activity is >468 pmol/min/µg, as measured under the described conditions.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	77.24 kDa
Gene Symbol	MMP-9

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP00103-5ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 5 ug

available

Delivery expected until 10/2/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer