« Back
Home /
Recombinant Human Basigin/EMMPRIN/CD147 Protein

Recombinant Human Basigin/EMMPRIN/CD147 Protein

Item no.	RP00104-100ug
Manufacturer	Abclonal
Amount	100 ug
Quantity options	100 ug 200 ug 20 ug 50 ug
Category	Neuroscience Neural Lineage Markers Peptides & Proteins Recombinant Proteins Adhesion Molecule Markers
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 95% by SDS-PAGE.
Sequence	TVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSH
NCBI	Basigin/CD147
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	5F7,CD147,EMMPRIN,OK,TCSF,BSG,5F7,basigin,CD147,EMMPRIN,OK,TCSF,basigin
Similar products	CD147, 5F7, EMMPRIN, TCSF, OK
Shipping Condition	Cool pack
Available
Manufacturer - Applications	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	46.71 kDa
Manufacturer - Additional Information	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description	Recombinant Human Basigin/EMMPRIN/CD147 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Thr25-His205) of human CD147/EMMPRIN/Basigin (Accession #NP_001719.2) fused with an Fc, 6×His tag at the C-terminus.
Background	This protein is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. The encoded protein is also a member of the immunoglobulin superfamily. Multiple transcript variants encoding different isoforms have been found for this gene.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Thr25-His205
Route	C-hFc&His
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Research Area	Bio-Markers & CD Antigens, Biosimilar Drug Targets
Antigen Seq	TVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSH
Bioactivity	Measured by its binding ability in a functional ELISA.Immobilized Human CD147 at 1μg/mL (100 μL/well) can bind CD147 Mouse mAb with a linear range of 0. 12-3. 05 ng/ml.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	46.71 kDa
Gene Symbol	Basigin/CD147

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP00104-100ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 10/2/2025

Compare

Add to wishlist

Get an offer

Request delivery time