« Back
Home /
Recombinant Human Low-density lipoprotein receptor/LDLR Protein

Recombinant Human Low-density lipoprotein receptor/LDLR Protein

Item no.	RP00152-20ug
Manufacturer	Abclonal
Amount	20 ug
Quantity options	10 ug 20 ug 50 ug 5 ug
Category	Neuroscience Metabolism Cholesterol & Lipid Metabolism Targets for Rodent Neurosciences Peptides & Proteins Recombinant Proteins Obesity Lipid & Fatty Acid Transport
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 90% by SDS-PAGE.
NCBI	Low-density lipoprotein receptor/LDLR
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	LDLR,FH,FHC,LDLCQ2,low-density lipoprotein receptor,FH,FHC,LDLCQ2
Similar products	LDLR, FH, FHC, LDLCQ2, LDL Receptor
Shipping Condition	Cool pack
Available
Manufacturer - Applications	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	85.62 kDa
Description	Recombinant Human Low-density lipoprotein receptor/LDLR Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala22-Arg788) of human LDLR/LDL Receptor (Accession #NP_000518.1) fused with a 6×His tag at the C-terminus.
Background	The low density lipoprotein receptor (LDLR) family consists of cell surface proteins involved in receptor-mediated endocytosis of specific ligands. Low density lipoprotein (LDL) is normally bound at the cell membrane and taken into the cell ending up in lysosomes where the protein is degraded and the cholesterol is made available for repression of microsomal enzyme 3-hydroxy-3-methylglutaryl coenzyme A (HMG CoA) reductase, the rate-limiting step in cholesterol synthesis. At the same time, a reciprocal stimulation of cholesterol ester synthesis takes place. Mutations in LDLR gene lead to the autosomal dominant disorder, familial hypercholesterolemia.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Ala22-Arg788
Route	C-His
Manufacturer - Research Area	Other Recombinant Protein
Revised name	FH, FHC, LDLR, LDL Receptor, LDLCQ2
Antigen Seq	AVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTEAEAAVATQETSTVRLKVSSTAVRTQHTTTRPVPDTSRLPGATPGLTTVEIVTMSHQALGDVAGRGNEKKPSSVR
Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized Human LDLR at 5μg/mL (100 μL/well) can bind Human PCSK9 with a linear range of 0. 5-294. 7ng/mL.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	85.62 kDa
Gene Symbol	Low-density lipoprotein receptor/LDLR

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP00152-20ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ug

available

Delivery expected until 10/2/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer