Comparison

Recombinant Human TNFRSF17/BCMA/CD269 Protein European Partner

Item no. RP00155-50ug
Manufacturer Abclonal
Amount 50 ug
Quantity options 100 ug 10 ug 200 ug 20 ug 500 ug 50 ug 5 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 92% by SDS-PAGE.
Sequence MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA
NCBI TNFRSF17/BCMA/CD269
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias TNFRSF17,BCM,BCMA,CD269,TNFRSF13A
Similar products CD269, BCMA, BCM, TNFRSF13A
Shipping Condition Cool pack
Available
Manufacturer - Applications
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
32.69 kDa
Manufacturer - Additional Information
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Recombinant Human TNFRSF17/BCMA/CD269 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Ala54) of human TNFRSF17/BCMA/CD269 (Accession #NP_001183.2) fused with an Fc, 6×His tag at the C-terminus.
Background
Tumor necrosis factor receptor superfamily, member 17 (TNFRSF17), also known as B cell maturation antigen (BCMA) or CD269 antigen, is a member of the TNF-receptor superfamily. This receptor is preferentially expressed in mature B lymphocytes, and may be important for B cell development and autoimmune response. This receptor has been shown to specifically bind to the tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B/TALL-1/BAFF), and to lead to NF-kappaB and MAPK8/JNK activation. This receptor also binds to various TRAF family members, and thus may transduce signals for cell survival and proliferation.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Met1-Ala54
Route
C-hFc&His
Endotoxin
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
CAR-T Cell Therapy Targets, Bio-Markers & CD Antigens, TNF family, Biosimilar Drug Targets
Antigen Seq
MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA
Bioactivity
1. Measured by its binding ability in a functional ELISA. Immobilized recombinant human BAFF at 5 μg/mL (100 μL/well) can bind recombinant human TNFRSF17 with a linear range of 3-20 ng/mL.|2. Loaded Human TNFRSF17/BCMA/CD269 Protein, C-hFc&His (Catalog: RP00155) on ProA Biosensor, can bind Human TNFSF13B/BAFF/CD257 Protein, no Tag (Catalog: RP00018) with an affinity constant of 2. 62 nM as determined in BLI assay (Gator).
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size
32.69 kDa
Gene Symbol
TNFRSF17/BCMA/CD269

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close