« Back
Home /
Recombinant Human NKp30/NCR3/CD337 Protein

Recombinant Human NKp30/NCR3/CD337 Protein

Item no.	RP00179-200ug
Manufacturer	Abclonal
Amount	200 ug
Quantity options	100 ug 10 ug 200 ug 20 ug 500 ug 50 ug
Category	Oncology By Cell Type Carcinoma Hematology Leukemia Lymphoma Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 95% by SDS-PAGE.
NCBI	NCR3/NKp30/CD337
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	NCR3,1C7,CD337,LY117,MALS,NKp30
Similar products	NKp30, NCR3, DAAP-90L16.3, 1C7, CD337, LY117, MALS
Shipping Condition	Cool pack
Available
Manufacturer - Applications	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	39.86 kDa
Description	Recombinant Human NKp30/NCR3/CD337 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu19-Thr138) of human NCR3/NKp300 (Accession #NP_001138938.1) fused with an Fc, 6×His tag at the C-terminus.
Background	Natural Cytotoxicity Triggering Receptor 3, NCR3, also known as NKp30, or CD337, is a natural cytotoxicity receptor. NKp30 is expressed on both resting and activated NK cells of the CD56dim, CD16+ subset that account for more that 85% of NK cells found in peripheral blood and spleen. NKp30 is absent from the CD56bright, CD16- subset that constitutes the majority of NK cells in lymph node and tonsil, however, its expression is up-regulated in these cells upon IL-2 activation .NKp30 is a member of the immunoglobulin superfamily and one of three existing natural cytotoxicity-triggering receptors. NKp30 is a glycosylated protein and is thought to be selectively expressed in resting and activated natural killer cells. NKp30 is a stimulatory receptor on human NK cells implicated in tumor immunity, and is capable of promoting or terminating dendritic cell maturation. NCR3 may play a role in inflammatory and infectious diseases.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Leu19-Thr138
Route	C-hFc&His
Manufacturer - Research Area	Immune Checkpoint, Bio-Markers & CD Antigens
Revised name	1C7, CD337, DAAP-90L16.3, LY117, MALS, NCR3, NKp30
Antigen Seq	LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGT
Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized recombinant Human B7-H6 at 2 μg/mL (100 μL/well) can bind recombinant Human NCR3, the EC₅₀ of Human NCR3 is 66. 43 ng/mL.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	39.86 kDa
Gene Symbol	NCR3/NKp30/CD337

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP00179-200ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200 ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer