Comparison

Recombinant Human TNFRSF11B/Osteoprotegerin Protein European Partner

Item no. RP00180-200ug
Manufacturer Abclonal
Amount 200 ug
Quantity options 100 ug 10 ug 200 ug 20 ug 50 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 95% by SDS-PAGE.
NCBI TNFRSF11B/Osteoprotegerin
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias TNFRSF11B,OCIF,OPG,PDB5,TR1,TNF receptor superfamily member 11b,Osteoprotegerin,OCIF,OPG,PDB5,TR1
Shipping Condition Cool pack
Available
Manufacturer - Applications
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
44.46 kDa
Description
Recombinant Human TNFRSF11B/Osteoprotegerin Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Glu22-Leu401) of human Osteoprotegerin/TNFRSF11B (Accession #NP_002537.3) fused with a 6×His tag at the C-terminus.
Background
Osteoprotegerin or TNFRSF11B is a member of the TNF-receptor superfamily. This protein is an osteoblast-secreted decoy receptor that functions as a negative regulator of bone resorption. This protein specifically binds to its ligand, osteoprotegerin ligand, both of which are key extracellular regulators of osteoclast development. Studies of the mouse counterpart also suggest that this protein and its ligand play a role in lymph-node organogenesis and vascular calcification.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Glu22-Leu401
Route
C-His
Manufacturer - Research Area
TNF family
Revised name
MGC29565, OCIF, OPG, PDB5, TR1
Antigen Seq
ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL
Bioactivity
1. Measured by its binding ability in a functional ELISA. Immobilized Recombinant human TNFRSF11B at 2 μg/mL (100 μL/well) can bind Recombinant human TNFSF11 with a linear range of 2-8 ng/mL.|2. Measured by its ability to inhibit TRAIL-mediated cytotoxicity using L-929 mouse fibroblast cells treated with TRAIL. The ED50 for this effect is 28. 5-114 pg/mL in the presence of 20 ng/mL Recombinant Human TRAIL/TNFSF10.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size
44.46 kDa
Gene Symbol
TNFRSF11B/Osteoprotegerin

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close