« Back
Home /
Recombinant Human IFN-gamma R1/CD119 Protein

Recombinant Human IFN-gamma R1/CD119 Protein

Item no.	RP00200-200ug
Manufacturer	Abclonal
Amount	200 ug
Quantity options	100 ug 10 ug 200 ug 20 ug 50 ug
Category	Oncology By Cell Type Melanoma Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 95% by SDS-PAGE.
NCBI	IFN-gamma R1/CD119
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CD119,IFNGR,IMD27A,IMD27B,IFNGR1,CD119,interferon gamma receptor 1,IFNGR,IMD27A,IMD27B
Similar products	CD119, IFNGR, IMD27A, IMD27B
Shipping Condition	Cool pack
Available
Manufacturer - Applications	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	28.47 kDa
Description	Recombinant Human IFN-gamma R1/CD119 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Gly245) of human IFNGR1/CD119 (Accession #NP_000407.1) fused with a 6×His tag at the C-terminus.
Background	The high-affinity IFN-gamma receptor complex is made up of two type I membrane proteins, IFN-gammaR1 (IFN gamma R alpha ) and IFN-gammaR2 (IFN-gamma R beta ). IFN-gamma R1 is the ligand-binding subunit that is necessary and sufficient for IFN-gamma binding and receptor internalization. IFN-gammaR2 is required for IFN gamma signaling but does not bind IFN-gamma by itself. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Met1-Gly245
Route	C-His
Manufacturer - Research Area	Bio-Markers & CD Antigens, Cytokines & Cytokine receptors
Revised name	CD119, IFNGR, IMD27A, IMD27B
Antigen Seq	MALLFLLPLVMQGVSRAEMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKG
Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized Human FNGR1/CD119 at 1 μg/mL (100 μL/well) can bind Human IFNG with a linear range of 0. 98-1. 97 ng/mL.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	28.47 kDa
Gene Symbol	IFN-gamma R1/CD119

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP00200-200ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200 ug

available

Delivery expected until 10/2/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer