Comparison

Recombinant Human Frizzled-7/FZD7 Protein European Partner

Item no. RP00204-5ug
Manufacturer Abclonal
Amount 5 ug
Quantity options 100 ug 10 ug 20 ug 50 ug 5 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 95% by SDS-PAGE.
NCBI Frizzled-7/FZD7
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias FZD7,FzE3
Similar products FzE3, Fz-7, hFz7
Shipping Condition Cool pack
Available
Manufacturer - Applications
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
43.49 kDa
Description
Recombinant Human Frizzled-7/FZD7 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln33-Leu185) of human Frizzled-7 (Accession #NP_003498.1) fused with an Fc, 6×His tag at the C-terminus.
Background
Frizzled-7 is a member of the Frizzled family of unconventional G-protein-coupled glycoprotein receptors for the Wnt signaling pathway. During development, Frizzled-7 is expressed during gastrulation and in the fetal gut, kidney and lung where it is thought to influence tissue morphogenesis via non-canonical signaling pathways . In the adult, Frizzled-7 is expressed in skeletal muscle, especially in satellite cells that mediate muscle regeneration in response to Wnt-7a. It is expressed in embryonic stem cells (ES), contributing to self-renewal signaling . Frizzled-7 expression may downregulate APC function and enhance beta-catenin-mediated signals in poorly differentiated human esophageal carcinomas.
Immunogen
Gln33-Leu185
Route
C-hFc&His
Manufacturer - Research Area
Other Recombinant Protein
Revised name
Fz-7, hFz7, FzE3
Antigen Seq
QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYL
Bioactivity
1. Measured by its binding ability in a functional ELISA. Immobilized Human Glypican-3 Protein at 5 μg/mL (100 μL/well) can bind Human FZD7 with a linear range of 4. 88-935. 5 ng/mL.|2. Measured by its binding ability in a functional ELISA. Immobilized Human Glypican-3 Protein at 5 μg/mL (100 μL/well) can bind Human FZD7 with a linear range of 4. 88-520. 4 ng/mL.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size
43.49 kDa
Gene Symbol
Frizzled-7/FZD7

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 5 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close