« Back
Home /
Recombinant Human Cathepsin D Protein

Recombinant Human Cathepsin D Protein

Item no.	RP00214-20ug
Manufacturer	Abclonal
Amount	20 ug
Quantity options	100 ug 10 ug 200 ug 20 ug 50 ug
Category	Oncology Neuroscience Aging & Neurological Disorders Protein Aggregation, Clearance & Misfolding Peptides & Proteins Recombinant Proteins Cell Biology Cell Status Apoptosis By Organ Breast Cancer Testicular & Prostate Cancer
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 95% by SDS-PAGE.
NCBI	Cathepsin D
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CLN10,CPSD,HEL-S-130P,Cathepsin D,CTSD
Similar products	CPSD, CLN10, HEL-S-130P
Shipping Condition	Cool pack
Available
Manufacturer - Applications	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	43.44 kDa
Description	Recombinant Human Cathepsin D Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu21-Leu412) of human Cathepsin D/CTSD (Accession #NP_001900.1) fused with a 6×His tag at the C-terminus.
Background	Cathepsin D (CTSD), a well known lysosomal aspartyl protease and belongs to the peptidase C1 family. It is expressed in most cells and overexpressed in breast cancer cells. It is a major enzyme in protein degradation in lysosomes, and also involved in the presentation of antigenic peptides. cathepsin D is essential for proteolysis of proteins regulating cell growth and tissue homeostasis. CTSD secreted from human prostate carcinoma cells are responsible for the generation of angiostatin, a potent endogenous inhibitor of angiogenesis, suggesting its contribution to the prevention of tumor growth and angiogenesis-dependent growth of metastases.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Leu21-Leu412
Route	C-His
Manufacturer - Research Area	Other Recombinant Protein
Revised name	CLN10, CPSD, HEL-S-130P
Antigen Seq	LVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
Bioactivity	Measured by its ability to cleave the fluorogenic peptide substrate, Mca-PLGL-Dpa-AR-NH2. The specific activity is >747 pmol/min/μg.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	43.44 kDa
Gene Symbol	Cathepsin D

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP00214-20ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ug

available

Delivery expected until 10/2/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer