« Back
Home /
Recombinant Human IFN-lambda 3/IL-28B Protein

Recombinant Human IFN-lambda 3/IL-28B Protein

Item no.	RP00219-100ug
Manufacturer	Abclonal
Amount	100 ug
Quantity options	100 ug 10 ug 200 ug 20 ug 50 ug 5 ug
Category	Neuroscience Neural Transcription Factors Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 95% by SDS-PAGE.
NCBI	IFN-lambda 3/IL-28B
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	IFNL3,IFN-lambda-3,IFN-lambda-4,IL-28B,IL-28C,IL28B,IL28C
Similar products	IL28B, IL28C, IL-28B, IL-28C, IFN-lambda-3, IFN-lambda-4
Shipping Condition	Cool pack
Available
Manufacturer - Applications	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	23.39 kDa
Description	Recombinant Human IFN-lambda 3/IL-28B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Val196) of human IFNL3/IL28B/Interleukin-28B (Accession #NP_742151.2) fused with a 6×His tag at the C-terminus.
Background	Interleukin-28B (IL-28B) also known as Interferon lambda-3 and IFN-lambda-3, belongs to the type III interferon family of cytokines. IL-28B is a cytokine with immunomodulatory activity. It functions in Up-regulating MHC class I antigen expression. IL-28B displays potent antiviral activity and antitumor activity. This cytokine serves as ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IL28RA. IL-28B is able to increase the percentage of splenic CD8+ T cells in vaccinated animals and have higher antigen-specific cytolytic .
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Met1-Val196
Route	C-His
Manufacturer - Research Area	Interleukin, Cytokines & Cytokine receptors
Revised name	IFN-lambda-3, IFN-lambda-4, IL-28B, IL-28C, IL28B, IL28C, IL-28B, IL28B, IL28C
Antigen Seq	MTGDCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV
Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human IL28B at 2 μg/mL (100 μL/well) can bind Recombinant Human IL10RB with a linear range of 0. 25-1 μg/mL.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, 500mM NaCl, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	23.39 kDa
Gene Symbol	IFN-lambda 3/IL-28B

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP00219-100ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 10/9/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer