Comparison

Recombinant Human TGF-beta receptor type-2/TGFR-2 Protein European Partner

Item no. RP00239-50ug
Manufacturer Abclonal
Amount 50 ug
Quantity options 100 ug 10 ug 20 ug 50 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 95% by SDS-PAGE.
Sequence TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPD
NCBI TGFR-2
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias AAT3,FAA3,LDS1B,LDS2,LDS2B,MFS2,RIIC,TAAD2,TGFR-2,TGFbeta-RII,TGF beta Receptor II,TGFBR2,AAT3,FAA3,LDS1B,LDS2,LDS2B,MFS2,RIIC,TAAD2,TGFR-2,TGFbeta-RII,TGF-beta receptor type-2
Similar products TGFR-2, FAA3, AAT3, LDS1B, LDS2B, MFS2, RIIC, TAAD2, TGFbeta-RII, LDS2
Shipping Condition Cool pack
Available
Manufacturer - Applications
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
42.30 kDa
Manufacturer - Additional Information
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Recombinant Human TGF-beta receptor type-2/TGFR-2 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Thr23-Asp159) of human TGFBR2 (Accession #NP_003233.4) fused with an Fc, 6×His tag at the C-terminus.
Background
Most cell types express three sizes of receptors for TGF-beta. These are designated Type I (53 kDa), Type II (70-85 kDa), and Type III (250-350 kDa). The Type III receptor, a proteoglycan that exists in membrane-bound and soluble forms, binds TGF-beta 1, TGF-beta 2, and TGF-beta 3 but does not appear to be involved in signal transduction. The Type II receptor is a membrane-bound serine/threonine kinase that binds TGF-beta 1 and TGF-beta 3 with high affinity and TGF-beta 2 with a much lower affinity. The Type I receptor is also a membrane-bound serine/threonine kinase that apparently requires the presence of the Type II receptor to bind TGF-beta. Current evidence suggests that signal transduction requires the cytoplasmic domains of both the Type I and Type II receptors.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Thr23-Asp159
Route
C-hFc&His
Endotoxin
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Cytokines & Cytokine receptors
Antigen Seq
TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPD
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized recombinant human TGFB1 at 2 μg/mL (100 μL/well) can bind recombinant human TGFBR2 with a linear range of 1-5 ng/mL.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size
42.30 kDa
Gene Symbol
TGFR-2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close