« Back
Home /
Recombinant Human Growth hormone receptor/GHR Protein

Recombinant Human Growth hormone receptor/GHR Protein

Item no.	RP00251-1000ug
Manufacturer	Abclonal
Amount	1000 ug
Quantity options	1000 ug 100 ug 200 ug 20 ug 500 ug 50 ug
Category	Oncology Neuroscience Neuroinflammation Metabolism Diabetes Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 95% by SDS-PAGE.
NCBI	Growth hormone receptor/GHR
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	GHR,GHBP,GHIP
Similar products	GHBP, GHIP
Shipping Condition	Cool pack
Available
Manufacturer - Applications	< 0.01 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	54.46 kDa
Description	Recombinant Human Growth hormone receptor/GHR Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ala 27 - Tyr 264 ) of human Growth Hormone Receptor (GHR) (Accession #NP_000154.1) fused with an Fc, 6×His tag at the C-terminus.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Ala27-Tyr264
Route	C-hFc&His
Manufacturer - Research Area	Biosimilar Drug Targets
Revised name	GHBP, GHIP
Antigen Seq	AILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFY
Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized Human GH at 2 μg/mL (100 μL/well) can bind Human GHR with a linear range of 0. 1-8. 58 ng/mL.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	54.46 kDa
Gene Symbol	Growth hormone receptor/GHR

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP00251-1000ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1000 ug

available

Delivery expected until 10/2/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer