« Back
Home /
Recombinant Human NKAT-2/KIR2DL3/CD158b2 Protein

Recombinant Human NKAT-2/KIR2DL3/CD158b2 Protein

Item no.	RP00277-20ug
Manufacturer	Abclonal
Amount	20 ug
Quantity options	100 ug 200 ug 20 ug 500 ug 50 ug
Category	Oncology By Cell Type Hematology Myeloma Peptides & Proteins Recombinant Proteins By Organ Testicular & Prostate Cancer
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 95% by SDS-PAGE.
Sequence	HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWLSPTEPSSETGNPRHLH
NCBI	NKAT-2/KIR2DL3/CD158b2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	KIR2DL3,CD158B2,CD158b,GL183,KIR-023GB,KIR-K7b,KIR-K7c,KIR2DS5,KIRCL23,NKAT,NKAT2,NKAT2A,NKAT2B,p58
Similar products	p58, NKAT, CD158b, CU464054.1, CD158B2, GL183, KIR-023GB, KIR-K7b, KIR-K7c, KIRCL23, MGC129943, NKAT2, NKAT2A, NKAT2B, KIR2DS5
Shipping Condition	Cool pack
Available
Manufacturer - Applications	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	51.38 kDa
Manufacturer - Additional Information	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description	Recombinant Human NKAT-2/KIR2DL3/CD158b2 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (His22-His245) of human KIR2DL3/CD158b2 (Accession #NP_056952.2) fused with an Fc, 6×His tag at the C-terminus.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	His22-His245
Route	C-hFc&His
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Research Area	Bio-Markers & CD Antigens
Antigen Seq	HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWLSPTEPSSETGNPRHLH
Bioactivity	Measured by its binding ability in a functional ELISA.Immobilized Human KIR2DL3 at 1 μg/mL (100 μL/well) can bind KIR2DL3 Rabbit pAb with a linear range of 2-54 ng/mL.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	51.38 kDa
Gene Symbol	NKAT-2/KIR2DL3/CD158b2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP00277-20ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ug

available

Delivery expected until 10/2/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer